Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
12052023 CC Packet
December 5, 2023 Port Angeles City Council Meeting Page 1 December 5, 2023 City of Port Angeles Council Meeting Agenda This meeting will be conducted as a hybrid meeting. In hybrid meetings, members of the public, Council members, and City sta ff have the option to attend the meeting in person, in Council chambers at City Hall located at 321 East 5th Street, Port Angeles, or remotely via telephone or video link. The Mayor may determine the order of business for a particular City Council meeting. The agenda should be arranged to best serve the needs and/or convenience of the Council and the public. The Mayor will determine time of break. Hearing devices are available for those needing assistance. The items of business for regular Council meetings may include the following: A. Call to Order – Regular Meeting at 6:00 p.m. B. Roll Call, Pledge of Allegiance Ceremonial Matters, Proclamations & Employee Recognitions C. Public Comment The City Council desires to allow the opportunity for Public Comment. However, the business of the City must proceed in an or derly and timely manner. Visit https://www.cityofpa.us/Live-Virtual-Meetings to learn how to participate during public comment and or watch the meeting live. Written public comments can be submitted to: council@cityofpa.us, comments will not be read aloud. To provide pre-recorded messages to the City Council by phone, please call 360 -417-4504. Messages received will be made a part of the final record. Comments should be received by 2:00 p.m. Tuesday, December 5, 2023. For audio only: 1-844-992-4726 Use access code: 2554 684 0129 Webinar password: mHvm7nvZZ94 (64867689 from phones and video systems) Once connected, press *3 to raise your virtual hand if you wish to make a comment or public testimony. You will be notified when it is your turn to speak. This access code is good for the Tuesday, December 5, 2023 meeting only. Webex link: https://cityofpa.webex.com/cityofpa/j.php?MTID=m03f2b21075d8f06f1195f02a37cbdd48 and wish to make a comment or public testimony, please use the “raise your hand” feature in Webex. You will be notified when it is your turn to speak. Members of the public may address the City Council at the beginning and end of any Regular Meeting under "Public Comment." During the "Public Comment" portion of the meeting, individuals may speak to agenda items, except those scheduled for a Publi c Hearing. The City Council desires to allow the opportunity for Public Comment. However, the business of the City must proceed in an orderly, timely manner. At any time, the presiding officer, in the presiding officer's sole discretion, may set such reaso nable limits as are necessary to prevent disruption of other necessary business. At its most restrictive, Public Comment shall be limited to a total of 15 minutes for the first Public Comment period and shall be concluded not later than 9:45 for the second Publi c Comment period. Individuals may speak for three (3) minutes or less, depending on the number of people wishing to speak. If more than 20 peop le are signed up to speak each speaker may be allocated two (2) minutes. Individuals who are residents of the City or own businesses within the City will be called to speak first, with preference gi ven to those who wish to speak to an item on the meeting’s agenda. If time remains, the presiding officer will call other individua ls wishing to speak, generally in the order in which they have signed in. If time is available, the presiding officer may call for addition al unsigned speakers. December 5, 2023 Port Angeles City Council Meeting Page 2 Persons speaking shall state their name, whether they reside within the City limits, whether they have any other pertinent co nnection to the City, and whether they are appearing as the representative of an organization. Excerpts: Council Rules of Procedure Section 12 D. Late Items To be placed on this or future agendas, including any executive session needed during or at the end of the meeting. E. Consent Agenda | Approve 1. City Council Minutes for October 24, 2023 / Approve .................................................................................................... E-1 2. Expenditure Report: From November 11. 2023 to November 24, 2023 in the amount of $1,254,190.75 / Approve ....... E-2 3. Pagefreezer 3-Year Agreement for Service / 1) Award a 3-year contract with Pagefreezer in the amount of $3,588.00 per year for software to archive and store social media content gathered on City of Port Angeles Facebook pages, and 2) authorize the City Manager to execute all documents necessary for this contract and to make minor modifications as necessary. .................................................................................................................................................................. E-17 4. Update and Renewal of Olympic Ambulance Services Agreement / 1) Approve the attached services agreement with Olympic Ambulance for the provision of emergency medical services within the City of Port Angeles and 2) authorize the City Manager to sign and implement the agreement and to make minor modifications to the agreement if necessary . ......... E-24 5. Agreement with National Cash Registry for Merchant Services / 1) Authorize the City Manager or his designee to sign the agreement with National Cash Registry for a three-year period in an amount not to exceed $600.00 per year plus transactional fees and 2) to make minor modifications, as necessary. ............................................................................ E-33 6. Reciprocal Fire Protection Act Agreement with Olympic National Park / 1) Approve attached Reciprocal Fire Protection Act Agreement with the United States Department of Interior, National Park Service and Olympic National Park for the provision of emergency services including, but not limited to, structural fire response, wildland fire control, emergency rescue and cooperative assistance and 2) authorize the City Manager and Fire Chief to sign the agreement. .............. E-47 7. Resolution Updating the City’s Fee Schedule / 1) Approve the resolution and 2) authorize the City Manager to make minor modifications, as necessary. ........................................................................................................................... E-57 8. Declaration of Emergency – Viewing Tower at City Pier / Pass the Resolution and ratify the Declaration of Emergency signed by the City Manager on November 21, 2023. ....................................................................................................... E-61 9. Lease Agreement Between the City and Lower Elwha Klallam Tribe for Use of the Carnegie Library Building / Approve the Carnegie Building Lease for the use of the Lower Elwha Klallam Tribe and authorize the City Manager to make minor modifications to the Lease Agreement as necessary. ............................................................................................ E-64 F. Public Hearings | 6:30 p.m. or Soon Thereafter 1. 2024 Budget / Continue Public Hearing / Close Public Hearing / Conduct 2 nd Reading / Adopt Ordinance ................. F-1 G. Ordinances Not Requiring Council Public Hearings 1. 2023 Budget Amendment #3 / Conduct 2nd Reading / Adopt Ordinance ........................................................................ G-1 H. Resolutions Not Requiring Council Public Hearings 1. Senior Center HVAC ....................................................................................................................................................... H-1 I. Other Considerations 1. 2024 Lodging Tax Advisory Committee Budget Recommendation / Adopt and Authorize ............................................ I-1 2. Association of Washington Cities City Action Days / Council Discussion .................................................................... I-12 3. Multi-Organizational Meeting on Elwha Legacy Forest & Power Plant Timber Sale / Council Discussion .................. I-14 J. Contracts & Purchasing 1. Big Boy Pond-Professional Services Agreement ............................................................................................................ J-1 2. Fire Department Vehicle Purchase .................................................................................................................................. J-24 K. Council Reports December 5, 2023 Port Angeles City Council Meeting Page 3 PUBLIC HEARINGS Public hearings are set by the City Council in order to meet legal requirements. City Council may set a public hearing in order to receive public input prior to making decisions which impact citizens. Certain matters may be controversial and City Council may choose to seek public opinion through the public hearing process. L. Information City Manager Reports: 1. Holiday Fund Raising and Volunteer Opportunities / .................................................................................................... L-1 2. Food Composting / Verbal Update M. Second Public Comment Follow the instructions from the first public comment period. Adjournment CITY COUNCIL SPECIAL MEETING Port Angeles, Washington October 24, 2023 This meeting was held virtually. ROLL CALL Mayor Dexter called the special meeting of the Port Angeles City Council to order at 5:00 p.m. Members Present: Mayor Dexter, Deputy Mayor Meyer, Council members Carr, McCaughan, and Schromen- Wawrin. Members Absent: Council members Miller and Suggs. Staff Present: City Manager West, Assistant City Manager Goings, Attorney Bloor, Clerk Martinez-Bailey, C. Delikat, D. Sharp, B. Smith, S. Carrizosa, M. Healy, M. Schneider, and H. Jones. WORK SESSION City Manager Nathan West began the work session and spoke about the purpose of the special meeting. He highlighted that the focus of discussion is on the City’s operating budget, which included a presentation on various funds and the upcoming budget schedule. Manager West said the meeting was an opportunity for staff to walk through the budget and hear input and feedback from Council. He said it was an opportunity for Council to weigh in on what staff have proposed and discuss as a group. In addition, he stated Council would be able to discuss reductions to the budget or suggest changes to revenue collections in order for staff to prepare a final Budget for adoption. He turned the meeting over to Finance Director Sarina Carrizosa who shared slides for all funds, provided information as to each section of the budget and stated the budget is balanced in the amount of $161,903.200.00 Council discussion followed. ADJOURNMENT Mayor Dexter adjourned the Special Meeting at 6:27 p.m. _____________________________________ _______________________________ Kate Dexter, Mayor Kari Martinez-Bailey, City Clerk December 5, 2023 E - 1 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount A/R MISCELLANEOUS REFUNDS RECORDING FEE 001-0000-213.10-90 203.50 CONWAY SHIELD CLOTHING & APPAREL 001-0000-237.00-00 (6.06) DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 001-0000-237.30-00 438.77 Division Total:$636.21 Department Total:$636.21 PACIFIC OFFICE EQUIPMENT INC SUPPLIES 001-1210-513.31-01 10.62 SUPPLIES 001-1210-513.31-01 27.10 SUPPLIES 001-1210-513.31-01 98.25 City Manager Division Total:$135.97 CIVICPLUS MEMBERSHIPS 001-1230-514.41-50 7,440.45 SOUND PUBLISHING INC COMMUNICATIONS/MEDIA SERV 001-1230-514.44-10 22.12 City Clerk Division Total:$7,462.57 City Manager Department Total:$7,598.54 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 001-2023-514.44-50 35.29 MISC TRAVEL H JONES-BARS/GAAP CLASS 001-2023-514.43-10 111.00 Accounting Division Total:$146.29 LEXISNEXIS FINANCIAL SERVICES 001-2025-514.41-50 217.60 Customer Service Division Total:$217.60 Finance Department Total:$363.89 LEXISNEXIS SUPPLIES 001-3030-515.49-01 435.20 City Attorney Division Total:$435.20 City Attorney Department Total:$435.20 FCS GROUP CONSULTING SERVICES 001-4060-558.41-50 2,710.00 SOUND PUBLISHING INC COMMUNICATIONS/MEDIA SERV 001-4060-558.41-15 102.70 Planning Division Total:$2,812.70 Community Development Department Total:$2,812.70 PSI ELECTRONICS, LLC TESTING&CALIBRATION SERVI 001-5010-521.45-21 221.55 Police Administration Division Total:$221.55 OLYMPIC PENINSULA HUMANE SOCIETY MISCELLANEOUS SERVICES 001-5012-521.41-50 16,250.00 MISCELLANEOUS SERVICES 001-5012-521.41-50 16,250.00 Intergovernmental Svcs Division Total:$32,500.00 PSI ELECTRONICS, LLC TESTING&CALIBRATION SERVI 001-5021-521.45-21 221.55 QUALITY TINTING & GLASS DESIGN MISCELLANEOUS SERVICES 001-5021-521.45-21 520.60 Investigation Division Total:$742.15 BOTACH POLICE EQUIPMENT & SUPPLY 001-5022-521.35-01 6,041.67 Page 1 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 2 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount LINCOLN STREET STATION SHIPPING AND HANDLING 001-5022-521.42-10 47.68 SHIPPING AND HANDLING 001-5022-521.42-10 15.48 SHIPPING AND HANDLING 001-5022-521.42-10 31.02 SHIPPING AND HANDLING 001-5022-521.42-10 47.49 MISC EMPLOYEE EXPENSE REIMBURSEMENT REIMBURSE FUEL VEH TRANSP 001-5022-521.45-21 60.00 OLYMPIC MEDICAL CENTER HEALTH RELATED SERVICES 001-5022-521.49-90 480.00 OLYMPIC PENINSULA COMMUNITY CLINIC MISC PROFESSIONAL SERVICE 001-5022-521.41-50 40,133.45 PSI ELECTRONICS, LLC TESTING&CALIBRATION SERVI 001-5022-521.45-21 775.46 Patrol Division Total:$47,632.25 LINCOLN STREET STATION SHIPPING AND HANDLING 001-5029-521.42-10 15.48 SHIPPING AND HANDLING 001-5029-521.42-10 21.13 PLATT ELECTRIC SUPPLY INC SALE SURPLUS/OBSOLETE 001-5029-521.31-01 26.26 THURMAN SUPPLY PRODUCTION&MANUFACTURING 001-5029-521.31-01 15.54 Records Division Total:$78.41 Police Department Total:$81,174.36 GLOBALSTAR USA 10-23 A/C00153767 001-6010-522.42-10 203.71 LEMAY MOBILE SHREDDING OFFICE MACHINES & ACCESS 001-6010-522.41-50 228.38 PUBLIC SAFETY TESTING INC DATA PROC SERV &SOFTWARE 001-6010-522.41-50 369.00 WSAFC MEMBERSHIPS 001-6010-522.49-01 1,836.00 Fire Administration Division Total:$2,637.09 CONWAY SHIELD CLOTHING & APPAREL 001-6020-522.31-11 74.96 CURTIS & SONS INC, L N CLOTHING & APPAREL 001-6020-522.20-80 171.94 CLOTHING & APPAREL 001-6020-522.31-11 3,131.58 SUPPLIES 001-6020-522.31-01 163.91 GALLS CLOTHING & APPAREL 001-6020-522.20-80 221.30 SEAWESTERN INC SUPPLIES 001-6020-522.31-01 293.76 SWAIN'S GENERAL STORE INC ELECTRICAL EQUIP & SUPPLY 001-6020-522.31-01 14.30 ZIEGLER APPAREL CLOTHING & APPAREL 001-6020-522.20-80 1,264.26 CLOTHING & APPAREL 001-6020-522.31-11 10.88 Fire Suppression Division Total:$5,346.89 ZIEGLER APPAREL CLOTHING & APPAREL 001-6045-522.20-80 26.11 Fire Training Division Total:$26.11 ANGELES PLUMBING INC CONSTRUCTION SERVICES,TRA 001-6050-522.31-20 490.18 Page 2 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 3 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount SWAIN'S GENERAL STORE INC SUPPLIES 001-6050-522.31-20 24.63 WALTER E NELSON CO BUILDING MAINT&REPAIR SER 001-6050-522.31-01 199.74 BUILDING MAINT&REPAIR SER 001-6050-522.31-01 212.70 BUILDING MAINT&REPAIR SER 001-6050-522.31-01 301.11 BUILDING MAINT&REPAIR SER 001-6050-522.31-01 123.40 Facilities Maintenance Division Total:$1,351.76 Fire Department Total:$9,361.85 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 001-8050-536.44-50 1,362.79 MATTHEWS BRONZE PA MARKERS, PLAQUES,SIGNS 001-8050-536.34-01 1,250.42 QUIRING MONUMENTS INC MARKERS, PLAQUES,SIGNS 001-8050-536.34-01 492.00 MARKERS, PLAQUES,SIGNS 001-8050-536.34-01 1,842.00 MARKERS, PLAQUES,SIGNS 001-8050-536.34-01 2,935.00 Ocean View Cemetery Division Total:$7,882.21 ANGELES MILLWORK & LUMBER SUPPLIES 001-8080-576.31-20 1,018.37 SUPPLIES 001-8080-576.31-20 35.87 SUPPLIES 001-8080-576.31-20 7.40 DEPT OF NATURAL RESOURCES CONSULTING SERVICES 001-8080-576.49-90 29.57 FAMILY SHOE STORE SHOES AND BOOTS 001-8080-576.31-01 234.96 FERRELLGAS INC AUTO & TRUCK ACCESSORIES 001-8080-576.31-20 79.25 MISC EMPLOYEE EXPENSE REIMBURSEMENT COX - MEAL REIMBURSEMENT 001-8080-576.31-01 37.00 FLANAGAN - MEAL REIMBURSE 001-8080-576.31-01 37.00 PORT OF PORT ANGELES REAL PROPERTY,RENT/LEASE 001-8080-576.45-30 6,423.83 SWAIN'S GENERAL STORE INC HAND TOOLS ,POW&NON POWER 001-8080-576.31-20 42.50 PAINTS,COATINGS,WALLPAPER 001-8080-576.31-20 43.49 EQUIP MAINT & REPAIR SERV 001-8080-576.31-20 74.77 JANITORIAL SUPPLIES 001-8080-576.31-20 21.73 SUPPLIES 001-8080-576.31-20 16.29 Parks Facilities Division Total:$8,102.03 Parks & Recreation Department Total:$15,984.24 ANGELES PLUMBING INC BUILDING MAINT&REPAIR SER 001-8131-518.31-20 308.70 WALTER E NELSON CO BUILDING MAINT&REPAIR SER 001-8131-518.31-01 71.87 Central Svcs Facilities Division Total:$380.57 Facilities Maintenance Department Total:$380.57 General Fund Fund Total:$118,747.56 OLYMPIC PENINSULA VISITOR MISC PROFESSIONAL SERVICE 101-1430-557.41-50 3,142.28 Page 3 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 4 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount BUREAU MISC PROFESSIONAL SERVICE 101-1430-557.41-50 6,000.00 PENINSULA ADVENTURE SPORTS 11-05 A/C 542276284-00001 101-1430-557.41-50 2,079.17 MISCELLANEOUS SERVICES 101-1430-557.41-50 1,858.77 MISCELLANEOUS SERVICES 101-1430-557.41-50 750.00 Lodging Excise Tax Division Total:$13,830.22 Lodging Excise Tax Department Total:$13,830.22 Lodging Excise Tax Fund Total:$13,830.22 3M SIGNS, SIGN MATERIAL 102-7230-542.31-25 3,496.55 SIGNS, SIGN MATERIAL 102-7230-542.31-25 270.91 ALPINE PRODUCTS, INC FIRST AID & SAFETY EQUIP.102-7230-542.31-01 82.69 GMCO SALT (SODIUM CHLORIDE) 102-7230-542.31-05 9,197.63 LAKESIDE INDUSTRIES INC ROAD/HWY MATERIALS ASPHLT 102-7230-542.31-20 1,348.85 MISC EMPLOYEE EXPENSE REIMBURSEMENT BOOT VOUCHER 776 REIMBURS 102-7230-542.31-01 300.00 PUD #1 OF CLALLAM COUNTY MISC PROFESSIONAL SERVICE 102-7230-542.47-10 20.55 MISC PROFESSIONAL SERVICE 102-7230-542.47-10 14.09 SARGENT ENGINEERING, INC ENGINEERING SERVICES 102-7230-542.41-50 210.56 ENGINEERING SERVICES 102-7230-542.41-50 210.56 SWAIN'S GENERAL STORE INC HAND TOOLS ,POW&NON POWER 102-7230-542.35-01 108.66 THURMAN SUPPLY AIR CONDITIONING & HEATNG 102-7230-542.31-20 238.27 Street Division Total:$15,499.32 Public Works-Street Department Total:$15,499.32 Street Fund Total:$15,499.32 CAPTAIN T'S CLOTHING & APPAREL 107-5160-528.31-11 241.93 CENTURYLINK 11-06 300539444 107-5160-528.42-11 67.49 CENTURYLINK-QWEST 360Z020380301B 107-5160-528.42-11 232.74 CLALLAM CNTY INFORMATION TECHNOLOGY DATA PROC SERV &SOFTWARE 107-5160-528.51-01 10,000.00 DR. PANZA LLC HEALTH RELATED SERVICES 107-5160-528.41-50 50.00 HEALTH RELATED SERVICES 107-5160-528.41-50 150.00 INTRADO LIFE & SAFETY SOLUTIONS DATA PROC SERV &SOFTWARE 107-5160-528.42-11 21,067.27 PUBLIC SAFETY TESTING INC HUMAN SERVICES 107-5160-528.41-50 391.75 QUALITY LOGO PRODUCTS ENGINEERING SERVICES 107-5160-528.31-61 8.61 PAPER & PLASTIC-DISPOSABL 107-5160-528.31-61 2,265.51 RICHMOND 2-WAY RADIO EXTERNAL LABOR SERVICES 107-5160-528.48-10 18,147.84 Page 4 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 5 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount SWAIN'S GENERAL STORE INC AIR CONDITIONING & HEATNG 107-5160-528.31-01 97.89 Pencom Division Total:$52,721.03 Pencom Department Total:$52,721.03 Pencom Fund Total:$52,721.03 LINCOLN STREET STATION SHIPPING AND HANDLING 175-5260-524.42-10 12.84 Code Enforcement Division Total:$12.84 Criminal Justice Department Total:$12.84 Code Compliance Enforcmt Fund Total:$12.84 AXON ENTERPRISE, INC. POLICE EQUIPMENT & SUPPLY 310-5950-594.65-10 21,150.72 Homeland Security Division Total:$21,150.72 Public Safety Projects Department Total:$21,150.72 ALLPLAY SYSTEMS, LLC FLOOR COVERING, INSTALLED 310-8985-594.65-10 85,685.71 BUILDERS EXCHANGE OF WA INC COMMUNICATIONS/MEDIA SERV 310-8985-594.65-10 56.55 SARGENT ENGINEERING, INC ENGINEERING SERVICES 310-8985-594.65-10 199.05 Misc Parks Projects Division Total:$85,941.31 Capital Proj-Parks & Rec Department Total:$85,941.31 Capital Improvement Fund Total:$107,092.03 HERRERA ENVIRONMENTAL CONSULTANTS CONSULTING SERVICES 312-7930-595.65-10 315.00 VANIR CONSTRUCTION MGMT, INC CONSULTING SERVICES 312-7930-595.65-10 28,052.50 GF-Street Projects Division Total:$28,367.50 Capital Projects-Pub Wks Department Total:$28,367.50 Transportation Benefit Fund Total:$28,367.50 ANIXTER ELECTRICAL EQUIP & SUPPLY 401-0000-141.41-00 1,623.30 MISC UTILITY DEPOSIT REFUNDS FINAL BILL REFUND 401-0000-122.10-99 4.34 FINAL BILL REFUND 401-0000-122.10-99 12.17 FINAL BILL REFUND 401-0000-122.10-99 15.35 FINAL BILL REFUND 401-0000-122.10-99 48.09 FINAL BILL REFUND 401-0000-122.10-99 55.23 FINAL BILL REFUND 401-0000-122.10-99 82.86 FINAL BILL REFUND 401-0000-122.10-99 192.14 FINAL BILL REFUND 401-0000-122.10-99 263.15 FINAL BILL REFUND 401-0000-122.10-99 264.95 Division Total:$2,561.58 Department Total:$2,561.58 Page 5 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 6 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount OLYMPIC PRINTERS INC PRINTING,SILK SCR,TYPSET 401-7111-533.31-01 224.13 Engineering-Electric Division Total:$224.13 PUD #1 OF CLALLAM COUNTY MISC PROFESSIONAL SERVICE 401-7120-533.33-50 3,775.88 Power Systems Division Total:$3,775.88 AMAZON CAPITAL SERVICES ELECTRICAL EQUIP & SUPPLY 401-7180-533.35-01 61.52 AIR CONDITIONING & HEATNG 401-7180-533.31-20 76.15 ELECTRICAL EQUIP & SUPPLY 401-7180-533.35-01 122.92 TOASTER/CONVECTION OVEN 401-7180-533.35-01 97.91 ANGELES PLUMBING INC BUILDING MAINT&REPAIR SER 401-7180-533.31-20 242.89 BUILDING MAINT&REPAIR SER 401-7180-533.31-20 325.89 BUILDING MAINT&REPAIR SER 401-7180-533.31-20 191.49 ANIXTER ELECTRICAL EQUIP & SUPPLY 401-7180-533.34-02 591.87 ELECTRICAL EQUIP & SUPPLY 401-7180-533.34-02 591.87 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 401-7180-533.44-50 74,504.46 HARTNAGEL BUILDING SUPPLY INC ELECTRICAL EQUIP & SUPPLY 401-7180-533.35-01 16.93 NORTHWEST SAFETY SERVICE, LLC SECURITY,FIRE,SAFETY SERV 401-7180-533.41-50 578.45 Electric Operations Division Total:$77,402.35 Public Works-Electric Department Total:$81,402.36 Electric Utility Fund Total:$83,963.94 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 402-0000-237.00-00 103.83 FERGUSON ENTERPRISES INC PIPE FITTINGS 402-0000-141.40-00 396.22 PIPE FITTINGS 402-0000-141.40-00 1,392.75 PIPE FITTINGS 402-0000-141.40-00 3,924.37 Division Total:$5,817.17 Department Total:$5,817.17 AMAZON CAPITAL SERVICES HARDWARE,AND ALLIED ITEMS 402-7380-534.31-01 229.81 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 402-7380-534.44-50 24,783.11 FEDERAL EXPRESS CORP SHIPPING CHARGES 402-7380-534.42-10 35.18 GRAINGER PRODUCTION&MANUFACTURING 402-7380-534.31-20 151.19 CHEMICAL LAB EQUIP & SUPP 402-7380-534.31-20 21.13 ELECTRONIC COMPONENTS 402-7380-534.31-20 36.00 EQUIPMENT MAINTENANCE 402-7380-534.31-20 289.22 NORTHWEST SAFETY SERVICE, LLC SECURITY,FIRE,SAFETY SERV 402-7380-534.41-50 115.69 Page 6 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 7 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount PACIFIC OFFICE EQUIPMENT INC SALES TAX 402-7380-534.31-01 5.50 PLATT ELECTRIC SUPPLY INC ELECTRONIC COMPONENTS 402-7380-534.31-20 53.04 PUD #1 OF CLALLAM COUNTY MISC PROFESSIONAL SERVICE 402-7380-534.47-10 50.34 SPECTRA LABORATORIES-KITSAP TESTING&CALIBRATION SERVI 402-7380-534.41-50 40.00 TESTING&CALIBRATION SERVI 402-7380-534.41-50 217.00 SWAIN'S GENERAL STORE INC PUMPS & ACCESSORIES 402-7380-534.35-01 55.24 PLASTICS 402-7380-534.31-20 35.87 THURMAN SUPPLY ELECTRICAL EQUIP & SUPPLY 402-7380-534.31-20 77.51 BARRELS, DRUMS, KEGS, CTN 402-7380-534.31-20 2,317.33 PUMPS & ACCESSORIES 402-7380-534.31-01 95.39 ELECTRICAL EQUIP & SUPPLY 402-7380-534.31-20 17.63 WALTER E NELSON CO LAUNDRY& DRY CLEAN COMPOD 402-7380-534.31-20 780.26 WIN-911 SOFTWARE SALES TAX 402-7380-534.48-02 70.40 Water Division Total:$29,476.84 ANGELES MILLWORK & LUMBER ROADSIDE,GRNDS,REC, PARK 402-7382-534.31-20 40.48 HEARTLINE AUTO & TRUCK MAINT. ITEMS 402-7382-534.31-20 143.45 PUD #1 OF CLALLAM COUNTY MISC PROFESSIONAL SERVICE 402-7382-534.47-10 53.20 SWAIN'S GENERAL STORE INC ROADSIDE,GRNDS,REC, PARK 402-7382-534.35-01 32.61 TACOMA HYDRAULICS PUMPS & ACCESSORIES 402-7382-534.31-20 18,041.22 Industrial Water Treatmnt Division Total:$18,310.96 Public Works-Water Department Total:$47,787.80 Water Utility Fund Total:$53,604.97 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 403-0000-237.00-00 125.36 NCL NORTH CENTRAL LABORATORIES CHEMICAL LAB EQUIP & SUPP 403-0000-237.00-00 (43.86) NORTHWEST PUMP AND EQUIPMENT CO EQUIP MAINT & REPAIR SERV 403-0000-237.00-00 (1,877.39) SHIPPING AND HANDLING 403-0000-237.00-00 (88.00) Division Total:($1,883.89) Department Total:($1,883.89) AARDING THERMAL ACOUSTICS USA SHIPPING AND HANDLING 403-7480-535.31-20 544.00 WATER SEWAGE TREATMENT EQ 403-7480-535.31-20 1,218.56 AMAZON CAPITAL SERVICES COMPUTER HARDWARE&PERIPHE 403-7480-535.31-60 34.73 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 403-7480-535.44-50 19,846.67 EDGE ANALYTICAL TESTING&CALIBRATION SERVI 403-7480-535.41-50 486.00 FASTENAL INDUSTRIAL FIRST AID & SAFETY EQUIP.403-7480-535.31-01 317.97 Page 7 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 8 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount FASTENAL INDUSTRIAL MATERIAL HNDLING&STOR EQP 403-7480-535.31-01 152.58 FASTENERS, FASTENING DEVS 403-7480-535.31-20 1.96 MATERIAL HNDLING&STOR EQP 403-7480-535.31-01 163.82 FIRST AID & SAFETY EQUIP.403-7480-535.31-01 143.51 FEDERAL EXPRESS CORP SHIPPING CHARGES 403-7480-535.42-10 199.59 SHIPPING CHARGES 403-7480-535.42-10 95.20 GRANICH ENGINEERED PRODUCTS INC AUTO & TRUCK MAINT. ITEMS 403-7480-535.31-20 8.70 ELECTRICAL EQUIP & SUPPLY 403-7480-535.31-20 549.44 SHIPPING AND HANDLING 403-7480-535.31-20 20.19 STEAM & HOT WATER FITTING 403-7480-535.31-20 222.39 HARBOR FREIGHT TOOLS HAND TOOLS ,POW&NON POWER 403-7480-535.35-01 34.80 MACDONALD MILLER SOLUTIONS, INC CONSTRUCTION SERVICES,HEA 403-7480-535.48-10 2,751.33 NAPA AUTO PARTS WATER SEWAGE TREATMENT EQ 403-7480-535.31-20 42.18 NCL NORTH CENTRAL LABORATORIES CHEMICAL LAB EQUIP & SUPP 403-7480-535.31-01 542.27 NORTHWEST PUMP AND EQUIPMENT CO EQUIP MAINT & REPAIR SERV 403-7480-535.48-10 23,211.39 SHIPPING AND HANDLING 403-7480-535.48-10 1,088.00 NORTHWEST SAFETY SERVICE, LLC SECURITY,FIRE,SAFETY SERV 403-7480-535.41-50 115.69 PETROCARD, INC FUEL,OIL,GREASE, & LUBES 403-7480-535.32-11 2,111.95 PLATT ELECTRIC SUPPLY INC ELECTRICAL EQUIP & SUPPLY 403-7480-535.31-20 344.83 PUD #1 OF CLALLAM COUNTY MISC PROFESSIONAL SERVICE 403-7480-535.47-10 280.21 SCHWING BIOSET INC SHIPPING AND HANDLING 403-7480-535.31-20 48.44 WATER SEWAGE TREATMENT EQ 403-7480-535.31-20 1,465.73 SIGMA ALDRICH CHEMICAL LAB EQUIP & SUPP 403-7480-535.31-01 115.82 SWAIN'S GENERAL STORE INC JANITORIAL SUPPLIES 403-7480-535.31-01 75.58 FOODS: PERISHABLE 403-7480-535.31-01 320.76 FIRST AID & SAFETY EQUIP.403-7480-535.31-01 110.99 HARDWARE,AND ALLIED ITEMS 403-7480-535.31-01 9.73 TENELCO MISCELLANEOUS SERVICES 403-7480-535.47-10 4,096.22 MISCELLANEOUS SERVICES 403-7480-535.47-10 4,125.34 MISCELLANEOUS SERVICES 403-7480-535.47-10 3,869.86 MISCELLANEOUS SERVICES 403-7480-535.47-10 3,973.11 MISCELLANEOUS SERVICES 403-7480-535.47-10 3,991.64 MISCELLANEOUS SERVICES 403-7480-535.47-10 4,098.86 Page 8 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 9 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount TENELCO MISCELLANEOUS SERVICES 403-7480-535.47-10 4,382.14 THURMAN SUPPLY PIPE FITTINGS 403-7480-535.31-20 63.68 PLUMBING EQUIP FIXT,SUPP 403-7480-535.31-20 26.94 BRUSHES (NOT CLASSIFIED) 403-7480-535.31-01 36.81 PIPE FITTINGS 403-7480-535.31-20 18.39 PIPE FITTINGS 403-7480-535.31-20 27.19 ULINE, INC BAGS,BAGGING,TIES,EROSION 403-7480-535.41-50 85.19 FIRST AID & SAFETY EQUIP.403-7480-535.41-50 44.45 HARDWARE,AND ALLIED ITEMS 403-7480-535.41-50 416.67 JANITORIAL SUPPLIES 403-7480-535.41-50 370.39 SALE SURPLUS/OBSOLETE 403-7480-535.41-50 0.01 WALTER E NELSON CO PAPER & PLASTIC-DISPOSABL 403-7480-535.31-01 97.59 PAPER & PLASTIC-DISPOSABL 403-7480-535.31-01 447.21 WASHINGTON (ECOLOGY), STATE OF BALLARD 2024 403-7480-535.49-01 135.00 DAILING 20214 403-7480-535.49-01 135.00 FREED-2024 403-7480-535.49-01 135.00 GAUL 2024 403-7480-535.49-01 135.00 RAYMOND 2024 403-7480-535.49-01 135.00 WHITE 2024 403-7480-535.49-01 135.00 WILLIAMS 2024 403-7480-535.49-01 135.00 Wastewater Division Total:$87,791.70 Public Works-Wastewater Department Total:$87,791.70 Wastewater Utility Fund Total:$85,907.81 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 404-0000-237.00-00 334.38 Division Total:$334.38 Department Total:$334.38 BRADY TRUCKING INC MISCELLANEOUS SERVICES 404-7538-537.41-51 10,891.92 CLALLAM CNTY SOLID WASTE DEPT BLDG CONSTRUC. SERVICES- 404-7538-537.49-90 6,080.32 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 404-7538-537.44-50 23,098.31 FASTENAL INDUSTRIAL FIRST AID & SAFETY EQUIP.404-7538-537.31-01 190.91 GRAINGER EQUIP MAINT & REPAIR SERV 404-7538-537.31-20 41.77 MISC EMPLOYEE EXPENSE REIMBURSEMENT MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 18.50 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 18.50 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 18.50 Page 9 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 10 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount MISC EMPLOYEE EXPENSE REIMBURSEMENT MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 37.00 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 37.00 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 37.00 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 37.00 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 55.50 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 55.50 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 55.50 MEAL TICKET - HOLIDAY - 1 404-7538-537.31-01 55.50 MEAL TICKET - OVERTIME - 404-7538-537.31-01 55.50 MEAL TICKET - OVERTIME - 404-7538-537.31-01 55.50 NORTHWEST SAFETY SERVICE, LLC SECURITY,FIRE,SAFETY SERV 404-7538-537.41-50 115.69 RABANCO, LTD MISCELLANEOUS SERVICES 404-7538-537.41-51 (18,171.31) MISCELLANEOUS SERVICES 404-7538-537.41-51 57,237.19 SWAIN'S GENERAL STORE INC HAND TOOLS ,POW&NON POWER 404-7538-537.35-01 18.46 SHOES AND BOOTS 404-7538-537.31-01 173.97 SW - Transfer Station Division Total:$80,213.73 AMAZON CAPITAL SERVICES OFFICE SUPPLIES, GENERAL 404-7580-537.31-01 68.32 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 404-7580-537.44-50 18,070.15 OLYMPIC PRINTERS INC PRINTING,SILK SCR,TYPSET 404-7580-537.41-15 602.75 Solid Waste-Collections Division Total:$18,741.22 AMAZON CAPITAL SERVICES CHEMICAL LAB EQUIP & SUPP 404-7585-537.48-10 65.16 ANGELES MILLWORK & LUMBER WATER&SEWER TREATING CHEM 404-7585-537.31-20 92.57 EDGE ANALYTICAL MISC PROFESSIONAL SERVICE 404-7585-537.41-50 62.00 Solid Waste-Landfill Division Total:$219.73 Public Works-Solid Waste Department Total:$99,174.68 Solid Waste Utility Fund Total:$99,509.06 ANGELES MILLWORK & LUMBER AUTO & TRUCK ACCESSORIES 406-7412-538.31-01 15.96 DEPARTMENT OF REVENUE EXCISE TAX RETURNS-OCT 406-7412-538.49-50 847.25 NORTHWEST SAFETY SERVICE, LLC SECURITY,FIRE,SAFETY SERV 406-7412-538.41-50 115.69 Stormwater Division Total:$978.90 Public Works-Wastewater Department Total:$978.90 Stormwater Utility Fund Total:$978.90 CEDAR GROVE COUNSELING, INC. SECURITY,FIRE,SAFETY SERV 409-6025-526.41-50 100.00 Page 10 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 11 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount CLALLAM CNTY EMS MEMBERSHIPS 409-6025-526.41-50 825.00 NOVEMBER MPD 409-6025-526.41-50 825.00 DR. PANZA LLC HEALTH RELATED SERVICES 409-6025-526.41-50 250.00 GALLS CLOTHING & APPAREL 409-6025-526.20-80 61.84 CLOTHING & APPAREL 409-6025-526.20-80 57.35 CLOTHING & APPAREL 409-6025-526.20-80 140.35 CLOTHING & APPAREL 409-6025-526.20-80 842.11 CLOTHING & APPAREL 409-6025-526.20-80 128.75 CLOTHING & APPAREL 409-6025-526.20-80 140.35 CLOTHING & APPAREL 409-6025-526.20-80 140.35 CLOTHING & APPAREL 409-6025-526.20-80 17.17 JIFFY CLEANERS CLOTHING & APPAREL 409-6025-526.20-80 16.32 CLOTHING & APPAREL 409-6025-526.20-80 47.87 CLOTHING & APPAREL 409-6025-526.20-80 10.88 MISC EMPLOYEE EXPENSE REIMBURSEMENT HARIK NMETC DEPOSIT REGIS 409-6025-526.43-10 200.00 BRANUM NREMT TEST FEE 409-6025-526.43-10 160.00 MISC ONE-TIME VENDORS TRAFFIC VESTS 409-6025-526.35-01 489.60 MISC TRAVEL BRANUM-NMETC PARAMEDIC SC 409-6025-526.43-10 616.00 BUTSCHER-NMETC PARAMEDIC 409-6025-526.43-10 616.00 GONZALEZ-NMETC PARAMEDIC 409-6025-526.43-10 616.00 OLYMPIC MEDICAL CENTER DOS 08-14-23 FITZGERALD 409-6025-526.41-50 270.50 OLYMPIC STATIONERS INC SUPPLIES 409-6025-526.31-01 26.07 PACIFIC OFFICE EQUIPMENT INC SUPPLIES 409-6025-526.31-01 153.97 SEQUIM MEDICAL ASSOCIATES MONTHLY FEE-PHYSICALS 409-6025-526.41-50 900.00 Medic I Division Total:$7,651.48 Fire Department Total:$7,651.48 Medic I Utility Fund Total:$7,651.48 CASCADIA LAW GROUP MISC PROFESSIONAL SERVICE 413-7481-535.41-50 427.70 INTEGRAL CONSULTING, INC CONSULTING SERVICES 413-7481-535.41-50 1,139.00 PKG LAW, PS MISC PROFESSIONAL SERVICE 413-7481-535.41-50 4,565.11 MISC PROFESSIONAL SERVICE 413-7481-535.41-50 7,432.50 Wastewater Remediation Division Total:$13,564.31 Public Works-Wastewater Department Total:$13,564.31 Harbor Clean Up Fund Total:$13,564.31 DAVE'S HEATING & COOLING SVC AIR CONDITIONING & HEATNG 421-7121-533.49-86 800.00 Page 11 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 12 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount DAVE'S HEATING & COOLING SVC AIR CONDITIONING & HEATNG 421-7121-533.49-86 800.00 HARTNAGEL BUILDING SUPPLY INC BUILDER'S SUPPLIES 421-7121-533.49-86 91.92 TRACY'S INSULATION CONSTRUCTION SERVICES,TRA 421-7121-533.49-86 742.50 Conservation Division Total:$2,434.42 Public Works-Electric Department Total:$2,434.42 Conservation Fund Total:$2,434.42 AMAZON CAPITAL SERVICES WATER SEWAGE TREATMENT EQ 452-7388-594.65-10 132.48 WATER SEWAGE TREATMENT EQ 452-7388-594.65-10 132.48 Water Projects Division Total:$264.96 Public Works-Water Department Total:$264.96 Water Utility CIP Fund Total:$264.96 KENNEDY/JENKS CONSULTANTS ARCHITECTURAL&ENGINEERING 463-7489-594.65-10 4,505.89 CSO Capital Division Total:$4,505.89 Public Works-Wastewater Department Total:$4,505.89 CSO Capital Fund Total:$4,505.89 AMAZON CAPITAL SERVICES AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 372.47 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 136.86 RADIO & TELECOMMUNICATION 501-0000-141.40-00 14.39 ASSOCIATED PETROLEUM PRODUCTS, INC FUEL,OIL,GREASE, & LUBES 501-0000-141.20-00 14,320.52 DOBBS PETERBILT INC AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 302.85 DON SMALL & SONS OIL DIST CO. AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 826.83 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 1,184.29 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 3,271.08 FASTENAL INDUSTRIAL AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 282.08 FIRE CHIEF EQUIPMENT CO, INC AUTO & TRUCK ACCESSORIES 501-0000-141.40-00 861.70 HEARTLINE AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 218.63 N C MACHINERY CO AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 268.71 NAPA AUTO PARTS AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 42.48 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 59.93 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 51.92 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 57.12 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 100.44 OWEN EQUIPMENT AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 1,636.60 PAPE-KENWORTH NORTHWEST, AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 121.04 Page 12 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 13 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount INC AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 756.23 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 543.96 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 1,470.02 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 49.95 AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 111.50 POMP'S TIRE SERVICE AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 2,027.33 TEREX UTILITIES INC AUTO & TRUCK MAINT. ITEMS 501-0000-141.40-00 347.75 Division Total:$29,436.68 Department Total:$29,436.68 AMAZON CAPITAL SERVICES AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 15.36 AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 152.31 ARAMARK LAUNDRY/DRY CLEANING SERV 501-7630-548.49-90 20.47 BAXTER AUTO PARTS #15 AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 19.56 AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 411.23 DAREN'S POINT S EXTERNAL LABOR SERVICES 501-7630-548.34-02 108.58 EXTERNAL LABOR SERVICES 501-7630-548.34-02 108.58 EXTERNAL LABOR SERVICES 501-7630-548.34-02 108.58 EXTERNAL LABOR SERVICES 501-7630-548.34-02 33.67 FASTENAL INDUSTRIAL AUTO & TRUCK MAINT. ITEMS 501-7630-548.31-01 231.49 HERMANN BROS LOGGING & CONST EXTERNAL LABOR SERVICES 501-7630-548.34-02 498.68 AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 22.82 LES SCHWAB TIRE CENTER AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 2,021.90 AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 2,858.01 EXTERNAL LABOR SERVICES 501-7630-548.34-02 348.30 NAPA AUTO PARTS AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 341.08 NORTHWEST SAFETY SERVICE, LLC SECURITY,FIRE,SAFETY SERV 501-7630-548.41-50 115.69 OFFICE DEPOT OFFICE SUPPLIES, GENERAL 501-7630-548.31-01 518.56 OWEN EQUIPMENT AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 1,141.12 PORT ANGELES POWER EQUIPMENT AUTO & TRUCK MAINT. ITEMS 501-7630-548.34-02 83.61 Equipment Services Division Total:$9,159.60 Public Works Department Total:$9,159.60 Equipment Services Fund Total:$38,596.28 ASTOUND BROADBAND 11-01 A/C 3401-1039516-01 502-2081-518.42-12 8,183.92 Page 13 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 14 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount DELL MARKETING LP COMPUTER HARDWARE&PERIPHE 502-2081-518.31-60 2,588.10 VERIZON WIRELESS 10-22 A/C 571136182-00001 502-2081-518.42-10 (71.82) 11-05 A/C 542276284-00001 502-2081-518.42-10 95.61 Information Technologies Division Total:$10,795.81 TYLER TECHNOLOGIES, INC DATA PROC SERV &SOFTWARE 502-2082-594.65-10 1,440.00 DATA PROC SERV &SOFTWARE 502-2082-594.65-10 2,160.00 DATA PROC SERV &SOFTWARE 502-2082-594.65-10 1,440.00 DATA PROC SERV &SOFTWARE 502-2082-594.65-10 2,880.00 IT Capital Projects Division Total:$7,920.00 Finance Department Total:$18,715.81 Information Technology Fund Total:$18,715.81 HSA BANK EMPLOYER CONTRIBUTION 503-1631-517.46-30 3,000.00 MISC ONE-TIME VENDORS CATERED WELLNESS BREAKFAS 503-1631-517.41-51 875.00 Other Insurance Programs Division Total:$3,875.00 Self Insurance Department Total:$3,875.00 Self-Insurance Fund Total:$3,875.00 CHAPTER 13 TRUSTEE CASE #21-10696 920-0000-231.56-90 358.00 EMPLOYEES ASSOCIATION PAYROLL SUMMARY 920-0000-231.55-30 685.00 EMPOWER-P/R WIRE PAYROLL SUMMARY 920-0000-231.52-20 25,173.95 FEDERAL PAYROLL TAX PAYROLL SUMMARY 920-0000-231.50-10 122,242.18 PENSIONER'S P/R TAX 920-0000-231.50-10 200.00 FICA/MEDICARE PAYROLL TAX PAYROLL SUMMARY 920-0000-231.50-20 135,841.34 HSA BANK EMPLOYEE CONTRIBUTION 920-0000-231.52-40 4,042.80 PAYROLL SUMMARY 920-0000-231.53-11 125.00 PAYROLL SUMMARY 920-0000-231.53-12 321.93 EMPLOYEE CONTRIBUTIONS 920-0000-231.52-40 1,000.00 JOHN HANCOCK LIFE INSURANCE CO PAYROLL SUMMARY 920-0000-231.52-25 1,645.22 LEOFF PAYROLL SUMMARY 920-0000-231.51-21 36,209.90 MISSION SQUARE-P/R WIRES PAYROLL SUMMARY 920-0000-231.52-10 31,589.46 OFFICE OF SUPPORT ENFORCEMENT PAYROLL SUMMARY 920-0000-231.56-20 1,116.83 PERS PAYROLL SUMMARY 920-0000-231.51-10 2,650.57 PAYROLL SUMMARY 920-0000-231.51-11 21,363.94 PAYROLL SUMMARY 920-0000-231.51-12 109,249.30 Page 14 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 15 City of Port Angeles City Council Expenditure Report Between Nov 11, 2023 and Nov 24, 2023 Vendor Description Account Number Amount TEAMSTERS LOCAL 589 PAYROLL SUMMARY 920-0000-231.54-10 2,286.00 PAYROLL SUMMARY 920-0000-231.54-10 2,286.00 UNITED WAY (PAYROLL) PAYROLL SUMMARY 920-0000-231.56-10 160.00 WSCFF/EMPLOYEE BENEFIT TRUST PAYROLL SUMMARY 920-0000-231.53-20 5,800.00 Division Total:$504,347.42 Department Total:$504,347.42 Payroll Clearing Fund Total:$504,347.42 Total for Checks Dated Between Nov 11, 2023 and Nov 24, 2023 $1,254,190.75 Page 15 of 15 Nov 29, 2023 3:32:46 PMDecember 5, 2023 E - 16 Date: December 5, 2023 To: City Council From: Kari Martinez-Bailey, City Clerk Subject: Pagefreezer 3-Year Agreement for Service Background / Analysis: Since 2016, the City has used Archive Social to store social media content that gathers on our social media pages. Because the City cannot rely on social media platforms to retain this information, it is necessary for the City to use another form of technology to capture social media content that accumulates on the City’s social media platforms. These platforms allow the City to search content, meet data recordkeeping requirements, automate the collection of online data, and collect social media user content in response to public record requests. The Washington State Public Records Act governs open records in Washington State. State requirements are very specific about web publications: “All state and local government agencies must retain all web content in accordance with the approved retention schedules” (434- 662-140 WAC) in their original format (434-662-050 WAC) and remain usable, searchable, retrievable and authentic for the length of the designated retention period (434-662-040 WAC). Metadata Statute 434-662-110 WAC also requires that appropriate metadata is collected for electronic records transferred to the digital archives, including the name of the originating agency, the date of transfer, the records series, and other appropriate metadata. Currently the City maintains a Facebook and LinkedIn presence. However, should the City choose to broaden its social media presence, Pagefreezer is not limited to Facebook and LinkedIn content alone. Services offered include unlimited record storage, and up to 12 social media accounts including Facebook, Twitter, LinkedIn, and Instagram. Pagefreezer is used by local state agencies, counties, cities and towns across Washington, including Association of Washington Cities, Jefferson County, and the City of Olympia. Summary: The City is required by State law to retain the records of its various social media channels. Since 2016, the City has used Archive Social to store social media content gathered on City of Port Angeles Facebook pages. The cost for this service is shared across six departments. In a continued effort to promote budgetary savings to the City’s budget, Staff considered other companies that provide this service and is recommending Council approve the agreement with Pagefreezer for records storage services. Funding: Costs for this service will be distributed across multiple departments according to use. Funding is available in the Human Resources, Community and Economic Development, Police, Fire, Public Works and Utilities and Parks and Recreation departments in the amount of $3,588.00. Recommendation: Award a 3-year contract with Pagefreezer in the amount of $3,588.00 per year for software to archive and store social media content gathered on City of Port Angeles Facebook pages, and authorize the City Manager to execute all documents necessary for this contract and to make minor modifications as necessary. December 5, 2023 E - 17 Under this contract, Pagefreezer costs are fixed, for the three-year contract period in the amount of $3,588.00 per year, with the first-year costs including a $250 website configuration and training charge. Current Archive Social yearly charges total $5,988 a year, meaning a savings of $2,400 per year with the recommended change to Pagefreezer. While the contract is below the $25,000 limit requiring Council approval, contracts that cross multiple budget years require Council approval regardless of the dollar amount and Staff is recommending Council approve the contract with Pagefreezer. Funding: Costs for this service will be distributed across multiple departments according to use. Funding is available in the Human Resources, Community and Economic Development, Police, Fire, Public Works and Utilities and Parks and Recreation departments in the amount of $3,588.00 as follows: Attachments: ▪ Pagefreezer informational sheet ▪ Contract with Pagefreezer for services 001-1220-516-4150 Human Resources $667 001-4060-58-4150 Community and Economic Development $1,329 001-5010-521-4150 Police $1,329 001-6010-522-4150 Fire $1,329 001-7010-532-4150 Public Works & Utilities $667 001-8010-574-4901 Parks & Recreation $667 December 5, 2023 E - 18 Pagefreezer Software, Inc. 400-311 Water Street, Vancouver, BC V6B 1B8 Canada www.pagefreezer.com 1.888.916.3999 sales@pagefreezer.com WASHINGTON STATE The Washington State Public Records Act (Wash. Rev. Code §42.56 et seq.) governs open records in Washington State. The act is very specific about web publications: “All state and local government agencies must retain all web content in accordance with the approved retention schedules” (434- 662-140 WAC) in their original format (434-662-050 WAC) and remain usable, searchable, retrievable and authentic for the length of the designated retention period (434-662-040 WAC). Metadata Statue 434-662-110 WAC also demands that appropriate metadata is collected for electronic records transferred to the digital archives, including the name of the originating agency, the date of transfer, the records series, and other appropriate metadata. It is important to note, CMS backups do not provide metadata. Pagefreezer has helped many Washington State agencies comply with these regulations. See an overview of our Washington State customers below and call us today to learn more call +1 888 916 3999, email sales@Pagefreezer.com or visit our website. “We needed to find a website archiving solution that met state document and communication retention requirements, and one that also made us ready to satisfy potential public records requests regarding website content. With Pagefreezer we now have true peace of mind knowing not only that we are in compliance with the regulations affecting us, but that we can also reproduce documents from our website easily to satisfy any public record request that comes our way.” - Clay Ghering, Director of Technology Services. Spokane Schools “Our biggest ROI is just knowing that Pagefreezer is taking care of things. It gives me peace of mind knowing I can access information from our social archives if I ever need it. I also particularly like the fact that is is cloud based, simplifying the sharing and collaboration process with those I give permission to.” - Toni Droscher, Communications Manager & Social Media Coordinator, Washington Contract #47QTCA18D00DD December 5, 2023 E - 19 Pagefreezer Software, Inc. 400-311 Water Street, Vancouver, BC V6B 1B8 Canada www.pagefreezer.com 1.888.916.3999 sales@pagefreezer.com STATE AGENCIES • Office of Governor Jay Inslee • Washington State Association of Counties • Washington Office of the Attorney General • Washington State Department of Health • Washington State Health Benefit Exchange • Washington State Health Care Authority • Washington State School Directors’ Association • Washington State Treasurer CITIES AND TOWNS • City of Arlington • City of Bellingham • City of Blaine • City of Camas • Town of Eatonville • City of Fircrest • City of Gig Harbor • City of Kalama • City of Kennewick • City of Kent • City of Kirkland • City of Liberty Lake • City of Long Beach • City of Longview • City of Marysville • City of Mill Creek • City of Mountlake Terrace • City of Olympia (State Capital) • City of Othello • City of Port Orchard • City of Puyallup • City of Quincy • City of Renton • City of Ridgefield • City of Seatac • City of Selah • City of Shoreline • City of Spokane Valley • City of Tacoma • City of Tenino • City of Wenatchee • City of Woodland COUNTIES • Clark County • Cowlitz County • Jefferson County • King County • San Juan County • Snohomish County • Spokane County • Stevens County • Pierce County FIRE AUTHORITIES • Camano Island Fire and Rescue • Central Kitsap Fire & Rescue • Central Pierce Fire & Rescue • East Jefferson Fire Rescue • East Pierce Fire & Rescue • Gig Harbor Fire and Medic One • Graham Fire & Rescue • Grays Harbor Fire District 5 • Lewis County Fire District 6 • Mountain View Fire Rescue • Port Ludlow Fire & Rescue • Renton Regional Fire Authority • Shoreline Fire Department • South Whatcom Fire Authority • Southeast Thurston Fire Authority • Thurston County Fire Protection District #3 • Valley Regional Fire Authority EDUCATION • Brinnon School District #46 • Chimacum School District • Clover Park Technical College • Ferndale School District • Organization for Educational Technology and Curriculum (OETC) • Port Angeles School District • Raymond School District • South Kitsap School District • Spokane Public Schools • Tumwater School Districts OTHER • Association of Washington Cities • Chelan County Emergency Management • Intercity Transit • JeffCom911 Communications • King County Housing Authority • Kitsap Public Health • Kitsap Transit • LEOFF Plan 2 Retirement Board • Lott Clean Water Alliance • Metro Parks Tacoma • Mid-Columbia Libraries • Pangborn Memorial Airport • Peninsula Metropolitan Park District • Port of Bremerton • Port of Everett • Sno-Isle Libraries • South Sound 911 • Spokane Regional Clean Air Agency • Stilly Valley Health Connections PHD#3 • Stream Team • Tacoma Public Utilities • Transportation Improvement Board • Valley Communications Center • Valley Transit • Vera Water and Power Contract #47QTCA18D00DD December 5, 2023 E - 20 City of Port Angeles - Social Media Archiving Prepared For Nathan West City of Port Angeles 321 East 5th Street Port Angeles WA 98362 United States Created By Cameron Gremell PageFreezer Software, Inc. (888) 916 3999 cameron@pagefreezer.com http://www.pagefreezer.com December 5, 2023 E - 21 City of Port Angeles - Social Media Archiving Pagefreezer Order Form 10 / 04 / 2023 Quote: 14164617124 Sales person: Cameron Gremell Email: cameron@pagefreezer.com Name Price QTY Subtotal Pagefreezer Public Records Compliance for Social Media Social Media Archiving for up to 12 social media accounts. Add-on accounts may be obtained at $35/month each. Unlimited Records. Unlimited Storage. Includes continuous account monitoring and archiving at the API (Application Programming Interface) level and replay of archives on PageFreezer.com. Open Record compliant. 1 administrative accounts are included with the PageFreezer account. API access/capture to/from Facebook, Twitter, LinkedIn, Instagram. $299.00 12 $3,588.00 Configuration and Training Personalized assistance for configuration of the website and social media accounts for archiving; creation of user account including access, user names and passwords; initial troubleshooting and quality assurance; administrative configuration for capture engine; test captures; capture optimization; QA cycle - internal; QA cycle - with client; 1:1 training session and access to unlimited weekly free online training. $250.00 1 $250.00 Helpdesk Standard Weekdays, 9am-5pm PST, excl. holidays, email, phone, web support, online ticket system, knowledge base, user documentation. $0.00 1 $0.00 One-time costs: $ 250.00 Annual Recurring: $ 3,588.00 Terms & Conditions December 5, 2023 E - 22 City of Port Angeles - Social Media Archiving This is a quotation on the goods named, subject to the following conditions: i) All prices in USD and excluding sales tax ii) PageFreezer Subscription Agreement: https://www.pagefreezer.com/pagefreezer_subscription_agreement_government/ iii) Payment per year up-front iv) Term of this agreement is 3 years. iv) Recurring annually until cancellation v) Cloud data storage in our SOC 1 & SOC 2 compliant datacenter in Seattle, WA. vi) Term start date January 1, 2024 vii) This quote is valid till December 8, 2023 In WITNESS WHEREOF, I have signed this agreement effective as of the day and year upon completion of signing. City of Port Angeles Signature:_______________________ Name: _____________________________ Title: _____________________________ Date: _______________________ PageFreezer Software, Inc. By: _______________________ Name: Peter Callaghan Title: Chief Revenue Officer Date: _______________________ December 5, 2023 E - 23 Date: To: From: Subject: December 5, 2023 City Council Derrell Sharp, Fire Chief Update and Renewal of Olympic Ambulance Services Agreement - Amended Start Date Background / Analysis: In 2016, the City of Port Angeles entered into a five-year agreement with Olympic Ambulance for the provision of emergency medical services (EMS) within the City of Port Angeles. This agreement included integrating Olympic Ambulance into the City of Port Angeles’ EMS system and included Olympic Ambulance’s adoption of the City’s billing protocols to ensure consistent billing for city residents regardless of whether the resident is transported by Port Angeles Fire Department or Olympic Ambulance. Included in this updated services agreement are agreeable deliverables that include: •Olympic shall staff a minimum of one (1) resource for the city 24 hours per day, 7 days per week for 9-1-1 responses to the following call types: Basic Life Support, Structure Fires, Cardiac Arrest, Water Rescue, and Motor Vehicle Collisions. •When responding as primary, Olympic shall target an average response time of 8 minutes or less 90% of the time. •When responding as secondary, Olympic shall maintain an average response time of 10 minutes or less 90% of the time. •Olympic units will notify PAFD personnel anytime they are responding from outside of the city limits. •Olympic Ambulance will make every effort to advise PenCom when no units are available to respond, or the response will be delayed. Summary: The services agreement between the City of Port Angeles and Olympic Ambulance for the provision of emergency medical services (EMS) within the City of Port Angeles has expired. The intent of this services agreement is to maintain a system for the seamless delivery of EMS services and patient care throughout the city. The term of this updated services agreement is set at five years and includes an annual review by both parties. Funding: Olympic Ambulance agrees to waive out of pocket charges to non-Medicare patients in which the patient’s insurance has met or exceeded the current Medicaid Allowable with attached Quality Assurance Fee. The parties agree to establish criteria to ensure that this Agreement complies with all regulations, rulings, determinations, and notices of the Office of Inspector General, Department of Health and Human Services. Funding synopsis provided in funding overview section of this council memo. Recommendation: Approve the attached services agreement with Olympic Ambulance for the provision of emergency medical services within the City of Port Angeles and authorize the City Manager to sign and implement the agreement and to make minor modifications to the agreement if necessary. December 5, 2023 E - 24 This services agreement maintains Olympic Ambulance as the primary transport agency for Basic Life Support services and Port Angeles Fire Department as the primary transport agency for Advanced Life Support services. Also included in this updated services agreement are conditions that Olympic Ambulance shall procure and maintain insurance without interruption from commencement of Olympic Ambulances work through the term of the agreement and for thirty (30) days after the physical completion date. Funding Overview: Olympic Ambulance and the City of Port Angeles Fire Department share goals of maintaining billing parity for City residents. The parties agree to establish criteria to ensure that these goals maintain compliance with all regulations, rulings, determinations, and notices of the Office of Inspector General, Department of Health and Human Services. In order to accomplish these goals; •Commercial Insurance: Olympic Ambulance agrees to waive out of pocket charges to commercially insured patients in which the patient’s insurance has met or exceeded the current Medicaid Allowable with attached Quality Assurance Fee. •Medicare Insurance: Olympic Ambulance shall be paid quarterly from the City’s Medic 1 utility in the amount of Medicare co-payments it waives and does not collect from City residents as a result of achieving billing parity in the City. •Medicaid Insurance: Olympic Ambulance shall bill Medicaid for rendered services with no out- of-pocket expense to City Residents or cost to the City’s Medic 1 utility. •Uninsured: Olympic Ambulance shall be paid quarterly from the City’s Medic 1 utility in the amount equal to the current Medicaid Allowable with attached Quality Assurance Fee for any uninsured residents that receive service from Olympic Ambulance. Attachment: Olympic Ambulance Services Agreement December 5, 2023 E - 25 Ambulance Services Agreement Between the City of Port Angeles and Olympic Ambulance Service, Inc. This Agreement (“Agreement”) is made by and between the City of Port Angeles, a non-charter code city and municipal corporation of the State of Washington, (“City”), and Olympic Ambulance Service Inc. (“Olympic”) a Washington State corporation, for the provision of emergency medical services (EMS) within the City of Port Angeles. For and in consideration of the covenants and promises set forth herein and the performances to be rendered, the parties hereby recite, covenant, and agree as follows: Intent The City of Port Angeles and Olympic Ambulance by this Agreement intend to form a system for delivery of EMS services and patient care. Through that process, the parties intend to accomplish the following objectives: •To provide for the seamless delivery of EMS within the City of Port Angeles •To eliminate medical billing disparity between agencies. •To achieve billing equivalency for City residents. •To ensure that City residents incur no out of pocket expenses for any medical transport. •To ensure a mutually beneficial relationship that emphasizes efficiency and patient care. •To integrate Olympic as a resource in the City’s EMS system. •To comply with Medicare billing practices in accordance with the Department of Health & Human Services’ CMS Carrier Manual and with the Office of the Inspector General’s opinion regarding those practices. Agreement To accomplish their intent, the parties agree to the following terms: •Olympic will be a component part of the City’s system for the provision of EMS service. •Olympic will be an integrated resource in the City’s EMS system. Olympic will adopt and follow the same billing protocols as currently used by the Port Angeles Fire Department (PAFD). •The parties will advise their medical billing service providers of the provisions of this Agreement and ask the service provider to help assure billing consistency so that residents of the City are charged the same for EMS transport regardless of whether the resident is transported by the City or Olympic. •If PAFD units are available and able to respond, PAFD will respond and provide service to all EMS calls for service within the City and will provide transportation to Olympic Medical Center (OMC) for all patients requiring Advanced Life Support (ALS) services. If a patient does not require ALS transport, Olympic will transport the patient to OMC if available. •If PAFD is unable to respond and provide service for whatever reason, they may request an ALS resource from Olympic to respond and transport. December 5, 2023 E - 26 •For consistency, for those EMS calls within the City, Olympic adopts PAFD’s Service Delivery Objectives. Consideration The consideration to Olympic shall be the greater of. 1.The reduction of Medicare revenue that Olympic incurs as a result of adopting the City’s billing protocols and practices; or 2.An amount equal to the current Medicaid Allowable with attached Quality Assurance Fee for any uninsured city residents that receive service from Olympic Ambulance. Olympic agrees to waive out of pocket charges to non-Medicare patients in which the patient’s insurance has met or exceeded the current Medicaid Allowable with attached Quality Assurance Fee. The parties agree to establish criteria to ensure that this Agreement complies with all regulations, rulings, determinations, and notices of the Office of Inspector General, Department of Health and Human Services. With the purpose of assuring such compliance, if the total amount collected varies by more than 20% from $12,000, which is the amount determined by the original retrospective 2014 audit period, then a new retrospective study will be conducted by Olympic Ambulance in collaboration with the City. This new study will be conducted using data from the entire contract period. If the study finds that the consideration to Olympic should be adjusted to achieve the criteria established in the preceding paragraph, the parties agree to adjust the consideration to Olympic so that, as nearly as practicable, the consideration is equal to the reduction of revenue that Olympic incurs as a result of adopting the City’s billing protocols and practices. Olympic Ambulance will, upon request, provide all supporting data used for the retrospective study. Term The term of this Agreement shall be for five years, commencing on January 1, 2024, the effective date of this Agreement. This Agreement shall be reviewed by both parties annually. This Agreement may be terminated by either party giving the other party one year’s written notice. Operating Protocols For the purposes of implementing the intents and agreements stated in this Agreement, the parties shall jointly adopt Operating Protocols. The City Manager for the City, and the Executive Director for Olympic, are hereby authorized to approve and adopt such Operating Protocols as they deem necessary to implement this Agreement and to amend such Operating Protocols as they find necessary from time to time. Dispatch Procedures PenCom will provide all dispatch services for 9-1-1 response to both parties. As partial consideration to Olympic for this Agreement, and in recognition that by this Agreement Olympic is made an integral component of the City’s EMS system, the City shall pay all PenCom fees for dispatching services provided to dispatch EMS calls inside the City, including dispatching Olympic in accordance with this Agreement. December 5, 2023 E - 27 Olympic units will be simultaneously dispatched to 9-1-1 requests within the City as agreed upon with PAFD. PAFD agrees to integrate Olympic into their Dispatch Run Cards to include EMS response to Basic Life Support, Structure Fires, Cardiac Arrest, Water Rescue, and Motor Vehicle Collisions. For all other incidents in which PAFD requires an Olympic response, PAFD may request the services of Olympic through PenCom. Olympic is authorized to use the PAFD radio frequency. This authority may be withdrawn without cause and is subject to the following conditions: •Radio communications shall be used for emergency purposes only. •Radio communications shall be brief and professional. Response Procedures Olympic units are authorized to respond code within the City when responding under this provision or when directed by PAFD personnel. When responding code, the use of OPTICOM devices by Olympic units is allowed. Olympic will adopt PAFD’s Service Delivery Objectives. Olympic agrees to the following deliverables: •Olympic shall staff a minimum of one (1) resource for the city 24 hours per day, 7 days per week for 9-1-1 requests listed in the above Dispatch Procedures. •When responding as primary, Olympic shall target an average response time of 8 minutes or less 90% of the time. •When responding as secondary, Olympic shall maintain an average response time of 10 minutes or less 90% of the time. •Olympic units will notify PAFD personnel anytime they are responding from outside of the City limits. •Olympic Ambulance will make every effort to advise PenCom when no units are available to respond or the response will be delayed. On-scene Procedures 1.The City and Olympic Ambulance both recognize that incident management responsibilities lie with PAFD. PAFD will be responsible for establishing appropriate level of incident command. 2.PAFD will provide for the extrication of all patients involved in motor vehicles accidents. Personnel without proper personal protective equipment for their designated assignment shall remain outside of the hazard area. Motor vehicles incidents will be managed by the incident command system and Olympic shall report to the incident commander for assignment. 3.Resource requests will be directed toward the designated incident commander or PAFD personnel in charge of emergency scene. If no PAFD personnel are on-scene, Olympic shall contact the on-duty officer or chief officer for additional resources. 4.Olympic Ambulance personnel will operate within the incident command structure. The supervisor or lead member from Olympic will maintain authority and responsibility over their personnel while still reporting to the incident commander for assignments. At no time will there December 5, 2023 E - 28 be freelancing, i.e. independent acts outside of the chain of command, on an emergency scene by either agency. Transportation Procedures 1.Olympic will transport patients requiring Basic Life Support services unless unavailable to do so. 2.PAFD will transport patients requiring Advanced Life Support unless unavailable or Olympic is requested to do so (e.g. resources on all hazard response, training at drill grounds, etc.). Billing Olympic agrees that each person who is transported by it shall be billed per the rates schedule filed with the City Clerk pursuant to PAMC 5.08.130; provided, however, that each person who is: (1) a City resident, or (2) is an employee of a business within the City (and the person or business is assessed a monthly utility charge under section 13.73.300 PAMC) shall not be billed beyond their insurance coverage, on the condition that the resident or employee (1) supplies all requested information and documentation including, but not limited to, insurance information and medical records relative to billing for the ambulance service; and (2) assigns to Olympic the patient’s right to receive payment from all applicable third-party payers, any co-payments and deductibles shall be waived. For the purpose of this section, a City resident refers to someone who has fixed or established place of residence inside the City, utilizes a dwelling unit inside the City as a fixed abode, and is not a guest, visitor, or other temporary inhabitant. A student who is regularly enrolled in an educational institution outside the City, but who would normally and regularly be a City resident but for attendance at such educational institution, shall be deemed to reside within the City. •For the purpose of implementing the billing rates and procedures described above, the parties shall jointly adopt detailed billing practices and protocols as agreed upon. The City Manager, for the City, and the Executive Director, for Olympic, are hereby authorized to approve and adopt such billing practices and protocols as they deem necessary to implement this Agreement and to amend such practices and protocols as they find necessary from time to time. •After the close of each calendar year, the parties shall perform a true-up audit and adjust the accounts as necessary to assure that Olympic is compensated for Medicare co-payments it waives but is not over-compensated. •To comply with Medicare billing practices in accordance with the Department of Health & Human Services CMS Carrier Manual and with the Office of the Inspector General’s opinion regarding those practices, Olympic shall be paid quarterly from the City’s Medic 1 utility the amount of Medicare co-payments it waives and does not collect from City residents. •With regard to non-Medicare patients, Olympic shall be paid from the City’s Medic 1 utility each quarter. This amount will be the agreed upon amounts referred to in “Consideration” above. Dispute Resolution In the event of any dispute concerning the terms of this Agreement or the breach thereof, the parties agree to make good faith efforts to resolve such dispute through direct discussions. If such efforts are unsuccessful, the parties agree to endeavor to settle the dispute by mediation. The mediator shall be selected by agreement of the parties. Following mediation, if either party gives to the other a written demand for arbitration, any unresolved controversy or claim arising from or relating to this Agreement December 5, 2023 E - 29 or breach thereof shall then be submitted to binding arbitration. In that event, each party shall appoint one arbitrator, and the two arbitrators first appointed shall appoint a third. The three arbitrators shall then hear and decide the dispute. All fees and expenses for the mediation or arbitration shall be borne by the parties equally. However, each party shall bear the expense of its own counsel, experts, witnesses, and preparation and presentation of evidence. Hold Harmless Olympic shall defend, indemnify, and hold harmless the City, its officers, officials, employees, and volunteers against and from any and all claims, injuries, damages, losses, or suits, including attorney’s fees, arising out of or resulting from the acts, errors, or omissions of Olympic or its employees in the performance of this Agreement. Insurance A.Term Olympic shall procure and maintain insurance, as required in this Section, without interruption from commencement of Olympic’s work through the term of the Contract and for thirty (30) days after the Physical Completion date, unless otherwise indicated herein. B.No Limitation Olympic’s maintenance of insurance, its scope of coverage and limits as required herein shall not be construed to limit the liability of Olympic to the coverage provided by such insurance, or otherwise limit the City’s recourse to any remedy available at law or in equity. C.Minimum Scope of Insurance Olympic’s required insurance shall be of the types and coverage as stated below: 1.Automobile Liability insurance covering all owned, non-owned, hired and leased vehicles. Coverage shall be at least as broad as Insurance Services Office (ISO) form CA 00 01. 2.Commercial General Liability insurance shall be at least as broad as ISO occurrence form CG 00 01 and shall cover liability arising from premises, operations, independent contractors, products-completed operations, stop gap liability, personal injury and advertising injury, and liability assumed under an insured contract. The Commercial General Liability insurance shall be endorsed to provide a per project general aggregate limit using ISO form CG 25 03 05 09 or an endorsement providing at least as broad coverage. There shall be no exclusion for liability arising from explosion, collapse or underground property damage. The City shall be named as an additional insured under Olympic’s Commercial General Liability insurance policy with respect to the work performed for the City using ISO Additional Insured endorsement CG 20 10 10 01 and Additional Insured-Completed Operations endorsement CG 20 37 10 01 or substitute endorsements providing at least as broad coverage. 3.Workers’ Compensation coverage as required by the Industrial Insurance laws of the State of Washington. D.Minimum Amounts of Insurance December 5, 2023 E - 30 Olympic shall maintain the following insurance limits: 1.Automobile Liability insurance with a minimum combined single limit for bodily injury and property damage of $1,000,000 per accident. 2.Commercial General Liability insurance shall be written with limits no less than $2,000,000 each occurrence, $2,000,000 general aggregate and $2,000,000 products-completed operations aggregate limit. E.City Full Availability of Olympic Limits If Olympic maintains higher insurance limits than the minimums shown above, the City shall be insured for the full available limits of Commercial General and Excess or Umbrella liability maintained by Olympic, irrespective of whether such limits maintained by Olympic are greater than those required by this Contract or whether any certificate of insurance furnished to the City evidences limits of liability lower than those maintained by Olympic. F.Other Insurance Provision Olympic’s Automobile Liability and Commercial General Liability insurance policies are to contain or be endorsed to contain that they shall be primary insurance as respect the City. Any insurance, self-insurance, or self-insured pool coverage maintained by the City shall be excess of Olympic’s insurance and shall not contribute with it. G.Acceptability of Insurers Insurance is to be placed with insurers with a current A.M. Best rating of not less than A: VII. H.Verification of Coverage Olympic shall furnish the City with original certificates and a copy of the amendatory endorsements, including but not necessarily limited to the additional insured endorsements, evidencing the insurance requirements of Olympic before commencement of the work. Upon request by the City, Olympic shall furnish certified copies of all required insurance policies, including endorsements, required in this Contract and evidence of all subcontractors’ coverage. I.Subcontractors’ Insurance Olympic shall cause each and every Subcontractor to provide insurance coverage that complies with all applicable requirements of Olympic-provided insurance as set forth herein, except Olympic shall have sole responsibility for determining the limits of coverage required to be obtained by Subcontractors. Olympic shall ensure that the City is an additional insured on each and every Subcontractor’s Commercial General liability insurance policy using an endorsement as least as broad as ISO CG 20 10 10 01 for ongoing operations and CG 20 37 10 01 for completed operations. J.Notice of Cancellation Olympic shall provide the City and all Additional Insureds for this work with written notice of any policy cancellation within two business days of their receipt of such notice. December 5, 2023 E - 31 K. Failure to Maintain Insurance Failure on the part of Olympic to maintain the insurance as required shall constitute a material breach of contract, upon which the City may, after giving five business days’ notice to Olympic to correct the breach, immediately terminate the Contract or, at its discretion, procure or renew such insurance and pay any and all premiums in connection therewith, with any sums so expended to be repaid to the City on demand, or at the sole discretion of the City, offset against funds due Olympic from the City. Licensing Olympic is required to maintain current Washington State licensing as well as licensing as required by Port Angeles Municipal Code. Olympic is responsible for compliance with all licensing verifications, certifications, and other qualifications necessary to provide the EMS services requested by this Agreement. Compliance Audits To ensure that the parties are complying with the terms of this Agreement, annual audits will be conducted to ensure smooth and effective operations and an accurate accounting of payments to Olympic for Medicare and Non-Medicare patients as well as an accurate accounting of payments from the City’s Medic One Fund. Audits may include compliance with Service Delivery Objectives, medical billing procedures, transport charges, and a random selection of those incidents where patients were released to Olympic for transport and those incidents where Olympic transports a patient ALS. Entire Agreement This Agreement, including its exhibits, constitutes the entire Agreement, supersedes all prior written or oral understandings, and may only be changed by a written amendment executed by both parties. City of Port Angeles Olympic Ambulance Service Inc. ________________ __________________________ By: By: ________________ __________________________ Date: Date: Attest: ______________________________ Approved by: ______________________________ December 5, 2023 E - 32 Date: December 5, 2023 To: City Council From: Calvin W. Goings, Assistant City Manager Sarina Carrizosa, Finance Director Shannen Cartmel, Community and Economic Development Manager Subject: Agreement with National Cash Registry for Merchant Services Background / Analysis: As part of the continued discussion and analysis of short-term rentals (STR) in the City of Port Angeles, Council authorized Staff to enter into an agreement with GovOS, LLS for data gathering and compliance services. As part of this agreement, GovOS will create a portal for STR registry. This portal is also capable of processing payments for services as well should the City choose to do so in the future. Creating a merchant account for acceptance of payments is a necessary step for completion of the portal. Initially, the City moved forward to utilize its current vendor for merchant services as part of this implementation. However, due to the inability of this vendor to meet the City’s deadlines, another merchant was selected from the options presented by GovOS of vendors that can meet the requirements of the portal and are also able to provide timely services to ensure this project moves forward as planned. From this list, City Staff have selected National Cash Registry (NCR) for merchant services on the GovOS platform. NCR has demonstrated their ability to meet the City’s needs and time commitments for this project. Additionally, NCR has successfully provided services for both corporations and municipalities for more than 130 years and has offered the City merchant services for the next three years for a fee of $50.00 per month plus a fee of 2.75% per transaction. Staff recommends Council authorize the City Manager or his designee to approve the agreement with NCR to ensure the City can meet the commitment to provide data and compliance options for STR’s as planned. Summary: On June 6, 2023, City Council approved a contract with GovOS, LLC for data gathering and compliance services of short-term rentals (STR) within the City of Port Angeles. As part of this scope of service, GovOS will provide solutions for compliance including establishing a portal where STR’s can be registered. As part of this process, it is necessary to establish connection to this portal with a merchant vendor capable to process payments should they be required in this future. This is a required portion of the portal setup. GovOS has provided Staff with a list of preferred vendors capable of meeting the requirements of the portal and Staff have selected National Cash Registry (NCR) from this list to provide these services. Funding: Funding is available as part of the initial $40,000 implementation of the GovOS agreement for services in the Community and Economic Development department budget. Recommendation: 1) Authorize the City Manager or his designee to sign the agreement with National Cash Registry for a three-year period in an amount not to exceed $600.00 per year plus transactional fees and 2) to make minor modifications, as necessary. December 5, 2023 E - 33 Funding Overview: Funding is available as part of the initial $40,000 implementation of the GovOS agreement for services in the Community and Economic Development department budget. Attachments: 1. Agreement for Merchant Services 2. Government Addendum December 5, 2023 E - 34 Merchant Application & Agreement Sales Agent Name: Sales Agent ID#: MCC Code: Page 1 of 7 NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI Rev: 01.31.2023 1.The Bank is the only entity approved to extend acceptance of Payment Network products directly to a Merchant. 2.The Bank must be a principle (signer) to the Merchant Agreement. 3.The Bank is responsible for educating Merchants on pertinent Operating Rules which Merchants must comply; this information may be provided to you by Processor. 4.The Bank is responsible for and must provide settlement funds to the Merchant. 5.The Bank is responsible for all funds held in reserve. 1.Ensure compliance with cardholder data security and storage requirements. 2.Maintain fraud and chargebacks below Payment Network thresholds. 3.Review and understand the terms of the Merchant Agreement. 4.Comply with Operating Rules. 5.Retain a signed copy of this Disclosure Page. The responsibilities listed above do not supersede the terms of the Agreement (as defined below) and are provided to ensure the Merchant understands some important obligations of each party and that the Bank is the ultimate authority should the Merchant have any problems. Merchant’s Signature Date Acquiring Bank Disclosure Citizens Bank, N.A. One Citizens Plaza, Providence, RI 02903 (401) 456-7096 (Internal Use Only) NCR Payment Solutions, LLC, 864 Spring Street, Atlanta, Georgia 30308 (“NCR” or “Processor”) will act as payment processor for the Merchant in connection with Transactions under the Agreement, except for Discover Network and American Express (OptBlue) card transactions where NCR will act as Merchant’s acquirer. Notwithstanding the foregoing, where the Merchant is boarded on the TSYS platform, NCR will act as payment processor for Merchant in connection with Transactions under the Agreement, except for American Express (OptBlue) card transactions, where TSYS will act as acquirer and processor, and Discover Network card transactions, where TSYS will act as processor and NCR will act as acquirer. Processor Disclosure Member Bank Responsibilities Important Merchant Responsibilities December 5, 2023 E - 35 Merchant Application & Agreement Merchant Business Information Legal Name (“Merchant”)Merchant DBA or Trade Name Federal Tax ID Legal Address City State Zip Code DBA / Location Address (P.O. Boxes not allowed)City State Zip Code DBA Phone Number:Fax Company Website (URL): Contact Information (select all that apply): Name email Phone Account Maintenance Statements PCI DSS Chargebacks Business Type Years in business:Length Owned: Years: Months: Any prior bankruptcies? Business: If Yes, when was the Filing Date?Personal Bankruptcy If Yes, when was the Filing Date? Does this location currently take AMERICAN EXPRESS™/VISA®/MASTERCARD®/DISCOVER Network®?Reason for leaving? Individual/Sole Proprietor Corporation Private Non-Profit PartnershipCorporation Publicly Traded Government LLC STATE Yes No Yes No Yes No Average Ticket Amount: $ Highest Ticket Amount $ Monthly Credit/Debit Card Volume $ Maximum Daily Sales: $ # of Daily Transactions: Nature of Business Vendor Name:Type of service:Email: Address:City State Zip Code Phone What type of service or product is being sold:Merchant Type: Sales Method: (by percent, total should = 100%) Card Present % Internet % Mail Order % Phone % Mobile % When is the card charged? When is the product or service delivered? Recurring Time of Sale: 1-3 Days 4-5 Days 6-10 Days 11-15 Days 30+ Days Payments % (If other, please explain): Seasonal Sales? What day(s) of the month:If yes, indicate months open: Other: Do you use a third party fulfillment house? If yes, provide name and phone Name :Phone: Do you use any third-party vendors related to accepting payments? If yes, provide type of service, name and contact info below. (Provide separate pages if needed.) Retail Restaurant MO/TO E-Commerce On Order On Shipment Other YesNo Yes No Yes No Page 2 of 7 NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI Rev: 01.31.2023 Refund Policy: No Refund Have you sold your future credit card receivables?Yes No No YesDo you require access to a virtual terminal (i.e. a web-based application that allows you to process electronic payments by telephone, mail order, fax, email, or in person)?If yes, please provide the virtual terminal contact's email December 5, 2023 E - 36 Address:City State Zip Code Card Brands to Accept VISA Mastercard Discover PIN DEBIT American Express EBT (requires additional setup)US Processing VISA Credit VISA Debit Mastercard CreditCanada Processing Mastercard Debit PPD CCDAdditional Processing: ACH Processing WEB TEL (ACH requires supporting documents) Card Not Present Questionnaire What percentage do you sell to: Business (B2B) % Consumer (B2C) % Do you sell:Do you sell a service or product?Do you own the product/inventory?Is the product stored at the DBA address above?Locally Nationally Service Product Yes No Yes No How do you advertise? (catalogs, magazines, internet, etc.) Are any other companies involved in the accepting, shipping, fulfilling the service or product, or the billing of the customer? If you currently take payments: How many chargebacks did you have for the previous year? Count: Total Amount: $ Catalogs Magazines Online - Advertising Other Yes No NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI Rev: 01.31.2023 FCS # Yes No PCI DSS Contact Name Page 3 of 7 If No, include address . Merchant’s Signature Date Merchant Application & Agreement Merchants may opt out of the Processor’s PCI DSS Compliance Program, but will be required to provide evidence of full compliance and breach insurance, with minimum coverage of $50,000. Supporting documentation can be provided directly to the Customer Support team. All Merchants that do not properly complete the steps required to become PCI DSS compliant will be charged a monthly noncompliance fee (disclosed in the Schedule A), until such evidence has been provided. PCI DSS Vendor Your PCI DSS Contact Email Merchant PCI DSS Information Is your organization currently compliant with Payment Card Industry Data Security Standards (PCI DSS)? Merchant's PCI DSS Contact Name Has your organization ever been involved in an Data Compromise Event (as defined in the Terms & Conditions)? Yes No PCI DSS Vendor Contact Email December 5, 2023 E - 37 Bank Information (Main Deposit account) Bank Name Account Name Account Type Routing #DDA Account #Account Type Authorized Representative and Signatory Information Authorized Representative/Signatory Name: Residence Address:City State Zip Code Country Email Home Phone Mobile Phone Social Security #Date of Birth US Citizen Yes No Ownership % (if owner): Owner Since: Driver’s License #State Issue Date Expiration Date Beneficial Owner and Control Person Information Name Title U.S Person: SSN Date of Birth Ownership (%) Address City State Zip Name Title U.S Person: SSN Date of Birth Ownership (%) Address City State Zip Name Title U.S Person: SSN Date of Birth Ownership (%) Address City State Zip Name Title U.S Person: SSN Date of Birth Ownership (%) Address City State Zip (1) The following information for each individual, if any, who, directly or indirectly, through any contract, arrangement, understanding, relationship or otherwise, owns 25% or more of the equity interests of the legal entity or sole proprietorship for which the account is being opened. Name of Owner U.S Person: SSN Date of Birth Ownership (%) Address City State Zip Non-U.S. Person(s): In lieu of a Social Security Number, may also provide a passport number, an alien identification card number, or number and country of issuance of any other government-issued document evidencing nationality or residence and bearing a photograph or similar safeguard. (2) The following information for one individual with significant responsibility for managing the legal entity listed above, such as: An executive officer or senior manager (e.g., Chief Executive Officer, Chief Financial Officer, Chief Operating Officer, Managing Member, General Partner, President, Vice President, Treasurer); or any other individual who regularly performs similar functions. (If appropriate, an individual listed under section (1) above may also be listed in this section (2). Page 4 of 7 Merchant Application & Agreement NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI Rev: 01.31.2023December 5, 2023 E - 38 Important Information About Procedures for Opening a New Account To help the government fight the funding of terrorism and money laundering activities, federal law requires all financial institutions to obtain, verify and record information that identifies each person (including business entities) who opens an account. When you open an account, NCR will request your name, residential/physical address, date of birth, taxpayer identification number and other information/documentation that will allow us to identify you. The undersigned entities/individuals hereby unconditionally authorize NCR, Bank or its agents to: (1) update such information periodically throughout the term of the Agreement; and (2) investigate the information and references contained in this Application, and to obtain additional information about the Merchant and such individuals by obtaining credit bureau and criminal background checks on the Merchant and its principals, including obtaining reports from consumer reporting agencies on individuals listed in this Application as an owner, general partner, control person, authorized representative, Signatory or Guarantor of Merchant, or providing their Social Security Number on this Application. To help the government fight financial crime, federal regulation requires certain financial institutions to obtain, verify, and record information about the beneficial owners of certain legal entity customers. The formation of legal entities can be used to disguise involvement in terrorist financing, money laundering, tax evasion, corruption, fraud, and other financial crimes. Requiring the disclosure of key individuals who own or control a legal entity helps law enforcement investigate and prosecute these crimes. For more information go to https://www.federalregister.gov/documents/2016/05/11/2016-10567/customer-due-diligence- requirements-for-financial-institutions. IRS Reporting Verification: Payment settlement entities are required to report to the Internal Revenue Service the amount of reportable payment card transactions. Merchant will receive an annual 1099-K providing details of your previous year’s reportable payment card transactions with a copy filed electronically with the IRS. By providing your email above, you consent to electronic delivery of the annual 1099. THE BUSINESS INFORMATION MUST MATCH IRS RECORDS, AND SHOULD BE THE SAME AS THE INFORMATION LISTED ON YOUR INCOME TAX RETURN. IF YOUR INFORMATION DOES NOT MATCH IRS RECORDS, THE PROCESSING OF YOUR APPLICATION MAY BE DELAYED AND YOU MAY BE SUBJECT TO MANDATORY BACKUP WITHHOLDING AS REQUIRED BY IRS REGULATIONS. American Express Disclosure: Existing Accounts: If you currently accept American Express (Amex), and your annual Amex volume is $1MM or more, you must provide your 10-digit AMEX SE #. This number will remain unchanged when you begin processing with NCR. Existing Amex SE#: New Accounts: If you do not currently accept Amex, and your annual volume is less than $1MM, we will establish an Amex account for you so you can start accepting Amex payments. If after you begin processing with us your Amex volume increases to more than $1MM annually, you could be converted to an Amex direct account, in accordance with the terms of the Agreement. If you do not currently accept Amex, and your annual volume is $1MM or more, you will need to contact Amex to set up a direct account. OPT-OUT OF AMEX MARKETING COMMUNICATIONS: If you do not wish to receive future commercial marketing communications from Amex, email customer service at assist.payments@ncr.com or check the box below. Opting-out of marketing messages will not preclude Merchant from receiving important transactional or relationship communications from Amex. Opt-Out of Amex Marketing: ________ Third Party Services Disclaimer: Merchant may select to participate in third-party services that are not provided by Bank. Merchant agrees that Bank is not a party to any agreement for services that are provided by a third-party and any such agreement is strictly between Merchant and the company providing the service. Merchant must be approved by each third-party company and each company may send its terms and conditions to the address of Merchant indicated herein upon such approval. Merchant agrees to be bound by such company's terms and conditions. Privacy Policy: NCR’s privacy policy is located at: https://www.ncr.com/privacy. Page 5 of 7 Merchant Application & Agreement NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI Rev: 01.31.2023December 5, 2023 E - 39 Acknowledgments and Signatures This Merchant Application, including any other applicable, amendments, schedules, exhibits, attachments and addenda hereto, as amended (the “Application”) is subject to review and approval by NCR and Bank. Merchant acknowledges receipt of the Merchant Card Processing Terms and Conditions located at https://www.ncr.com/terms- and-conditions/ under the link ‘Payment Solutions – Merchant Terms and Conditions’ (the “Terms & Conditions”). This Application and the Terms & Conditions are collectively referred to as the “Agreement”. All capitalized terms that are not defined in this Application have the meanings specified in the Terms & Conditions. This Agreement is between NCR Payment Solutions, LLC (“Processor” or “NCR”), the legal entity or sole proprietor identified as the merchant on the first page of this Application (the “Merchant”) and the Bank. Bank is a member of Visa, U.S.A., Inc. (“Visa”) and Mastercard International, Inc. (“Mastercard”). NCR is a registered acquirer of Discover Financial Services, LLC (“Discover”). The undersigned individual (“Signatory”) represents and warrants that Signatory is authorized to sign on behalf of Merchant and to bind Merchant to the terms of this Agreement. By signing below, Signatory certifies, on behalf of Merchant, that: (1) Merchant has received a full and complete copy of the Agreement; (2) Signatory has read, understands, and accepts all of the terms and conditions in the Agreement, and (3) all information provided in this Application is true, accurate, and complete. Signatory, on behalf of Merchant: (1) agrees to be bound by the terms of the Agreement, including the venue, jurisdiction and choice of law provisions in the Terms and Conditions; and (2) acknowledges that Merchant understands and agrees to comply with the Rules. Signatory authorizes NCR or its representative to: (1) perform a background investigation on Signatory and Merchant using a third-party credit reporting agency or other third party; (2) provide information in this Application to third parties for fraud and risk purposes; and (3) perform an initial and ongoing comprehensive credit inquiry or investigation. Merchant irrevocably authorizes NCR to initiate Automatic Clearing House (“ACH”) debit and/or credit entries from and to the designated bank account(s) for all fees, costs, and amounts due to NCR or payable to Merchant pursuant to this Agree- ment and the ACH rules and regulations. If a credit or debit entry is erroneously initiated, Merchant authorizes NCR to cor- rect the error. This ACH Authorization will remain in full force and effect until NCR has collected payment on all fees, costs, and amounts due or which may become due pursuant to the Agreement. The designated bank account may not be changed or altered without thirty (30) days’ prior written notice to NCR and the execution of any forms required by NCR. Whether or not NCR approves Merchant’s Application, Merchant’s submission of a transaction for processing, whether to NCR, Bank or NCR’s third-party providers, is an expression of Merchant’s consent to the terms of the Agreement. Merchant acknowledges and agrees that the Terms & Conditions are available at https://www.ncr.com/terms-and-conditions/ under the link for ‘Payment Solutions – Merchant Terms and Conditions’ and may be amended, revised, changed, or supplement- ed pursuant to relevant sections of the Terms & Conditions. The acceptance and processing of Transactions by Bank and/ or NCR shall be deemed the consent and execution by NCR and Bank of the Agreement and will evidence NCR’s and Bank’s receipt, approval of, and agreement to this Application signed by Merchant. This Agreement supersedes all prior agreements or representations between the parties whether written or oral regarding the subject matter of the Agreement. No modifications, alterations, or manual changes (including the deletion of fees) made to the Agreement will be effective unless NCR consents to such changes in a separate writing. This Agreement may be ex-ecuted in several counterparts, each of which will be deemed an original, but all of which together constitute one and the same Agreement. A signature or other indication of acceptance received electronically or via facsimile shall be legally binding for all purposes and equally effective as an ink signature. Merchant Legal Name: Signatory Signature: Signatory Name: Signatory Title: Date Page 6 of 7 NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI Rev: 01.31.2023December 5, 2023 E - 40 Unlimited Personal Guaranty As a key inducement for NCR and Bank to enter into the Agreement (as defined above), each individual or entity signing below (a “Guarantor”) agrees to be bound by all the terms and provisions of the Agreement the same as Merchant (as defined above). Each Guarantor understands that the Agreement may be renewed, extended, or modified from time to time (including with regard to fees and to Merchant’s payment obligations) without notice to Guarantor, even if the modifications and/or extensions increase Guarantor(s)’ obligations hereunder. Guarantor(s), individually and severally, also unconditionally and personally guarantee the Merchant’s full performance of its obligations under the Agreement. Guarantor(s) understand and agree that the NCR or Bank may proceed directly against Guarantor(s) without first exhausting remedies available against Merchant. Moreover, in the event Guarantor(s) is or are natural person(s), this guaranty is continuing and shall survive the death of Guarantor(s) and be binding on Guarantor(s)’ heirs and estate, without any diminution of the rights of NCR or Bank with respect to the guaranty. To the fullest extent permitted by law, Guarantor(s) waive all rights and defenses available to Guarantor(s) respecting the Bank or NCR’s enforcement of this guaranty. Without limiting any of the foregoing, each Guarantor agrees that his or her liability under this guaranty will not be limited or canceled because: (i) the Agreement cannot be enforced against the Merchant; (ii) either NCR or Bank makes or agrees to changes or modifications to the Agreement; (iii) NCR or Bank releases any other Guarantor or the Merchant from any obligation under the Agreement; (iv) a law, regulation or order of any public authority affects the rights of either NCR or Bank under the Agreement; or (v) anything else happens that may affect the rights of either NCR or Bank against the Merchant or any other Guarantor. Each Guarantor further agrees that: (vi) NCR and Bank each may delay enforcing any of its rights under this guaranty without losing such rights; (vii) NCR and Bank each can demand payment from such Guarantor without first seeking payment from the Merchant or any other Guarantor; and (viii) such Guarantor will pay all court costs, attorney’s fees, and collection costs incurred by either NCR or Bank in connection with the enforcement of any terms of the Agreement or this guaranty, whether or not there is a lawsuit, and such additional fees and costs as may be directed by a court. Guarantor Signature: Print Name: Date: Home Address (no P.O. box) Date of Birth: Phone Number: Guarantor Signature: Print Name: Date: Home Address (no P.O. box) Date of Birth: Phone Number: Page 7 of 7 NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI Rev: 01.31.2023December 5, 2023 E - 41 Schedule A Client Name Boarding Set Up 1. CIS system utilized 2. Web module utilized 3. IVR system utilized 4. POS system utilized 5. POS device(s) utilized 6. Merchant Category Code (MCC) The rates listed under Transaction Charges include interchange and other fees, charges and assessments imposed by the Bank or Payment Networks. Transactions that are not fully qualified transactions may be subject to mid-qualified or non-qualified rates and fees based on their interchange qualifications. Any rates and other percentage fees are calculated by multiplying the applicable rate or percentage fee by the value of each settled transaction on a per transaction basis. Other fees that are per item, per transaction or assessed periodically will be charged as indicated on each line item. See Section 7 of the Terms & Conditions for information more about Settlement, Chargebacks and Processing Fees, and Section 11 of the Terms & Conditions for more information about Processing Fees. Printed Name:Signed Date NCR Payment Solutions, LLC is a registered ISO/MSP of Citizens Bank, N.A., Providence, RI; BMO Harris Bank, Chicago, IL; Esquire Bank, Jericho, NY; and People’s Trust Company, Vancouver, BC © 2021 NCR Corporation 101821_Field_Payments_Schedule_A_Goverment ncr.com Fees Set up Fees FIXED Recurring Fees Transaction Charges Payment Type Payment Method Payment Limits Fee Per Transaction Fees Paid By Other Rates and Fees Options EMV Swipe Readers – $ Check Scanner - $500.00 per device Charge-backs (credit cards) NSF Check Returns Date: www.ncr.com December 5, 2023 E - 42 Form W-9 (Rev. August 2013) Department of the Treasury Internal Revenue Service Request for Taxpayer Identification Number and Certification Give Form to the requester. Do not send to the IRS.Print or type See Specific Instructions on page 2.Name (as shown on your income tax return) Business name/disregarded entity name, if different from above Check appropriate box for federal tax classification: Individual/sole proprietor C Corporation S Corporation Partnership Trust/estate Limited liability company. Enter the tax classification (C=C corporation, S=S corporation, P=partnership) ▶ Other (see instructions) ▶ Exemptions (see instructions): Exempt payee code (if any) Exemption from FATCA reporting code (if any) Address (number, street, and apt. or suite no.) City, state, and ZIP code Requester’s name and address (optional) List account number(s) here (optional) Part I Taxpayer Identification Number (TIN) Enter your TIN in the appropriate box. The TIN provided must match the name given on the “Name” line to avoid backup withholding. For individuals, this is your social security number (SSN). However, for a resident alien, sole proprietor, or disregarded entity, see the Part I instructions on page 3. For other entities, it is your employer identification number (EIN). If you do not have a number, see How to get a TIN on page 3. Note. If the account is in more than one name, see the chart on page 4 for guidelines on whose number to enter. Social security number –– Employer identification number – Part II Certification Under penalties of perjury, I certify that: 1. The number shown on this form is my correct taxpayer identification number (or I am waiting for a number to be issued to me), and 2. I am not subject to backup withholding because: (a) I am exempt from backup withholding, or (b) I have not been notified by the Internal Revenue Service (IRS) that I am subject to backup withholding as a result of a failure to report all interest or dividends, or (c) the IRS has notified me that I am no longer subject to backup withholding, and 3. I am a U.S. citizen or other U.S. person (defined below), and 4. The FATCA code(s) entered on this form (if any) indicating that I am exempt from FATCA reporting is correct. Certification instructions. You must cross out item 2 above if you have been notified by the IRS that you are currently subject to backup withholding because you have failed to report all interest and dividends on your tax return. For real estate transactions, item 2 does not apply. For mortgage interest paid, acquisition or abandonment of secured property, cancellation of debt, contributions to an individual retirement arrangement (IRA), and generally, payments other than interest and dividends, you are not required to sign the certification, but you must provide your correct TIN. See the instructions on page 3. Sign Here Signature of U.S. person ▶Date ▶ General Instructions Section references are to the Internal Revenue Code unless otherwise noted. Future developments. The IRS has created a page on IRS.gov for information about Form W-9, at www.irs.gov/w9. Information about any future developments affecting Form W-9 (such as legislation enacted after we release it) will be posted on that page. Purpose of Form A person who is required to file an information return with the IRS must obtain your correct taxpayer identification number (TIN) to report, for example, income paid to you, payments made to you in settlement of payment card and third party network transactions, real estate transactions, mortgage interest you paid, acquisition or abandonment of secured property, cancellation of debt, or contributions you made to an IRA. Use Form W-9 only if you are a U.S. person (including a resident alien), to provide your correct TIN to the person requesting it (the requester) and, when applicable, to: 1. Certify that the TIN you are giving is correct (or you are waiting for a number to be issued), 2. Certify that you are not subject to backup withholding, or 3. Claim exemption from backup withholding if you are a U.S. exempt payee. If applicable, you are also certifying that as a U.S. person, your allocable share of any partnership income from a U.S. trade or business is not subject to the withholding tax on foreign partners’ share of effectively connected income, and 4. Certify that FATCA code(s) entered on this form (if any) indicating that you are exempt from the FATCA reporting, is correct. Note. If you are a U.S. person and a requester gives you a form other than Form W-9 to request your TIN, you must use the requester’s form if it is substantially similar to this Form W-9. Definition of a U.S. person. For federal tax purposes, you are considered a U.S. person if you are: • An individual who is a U.S. citizen or U.S. resident alien, • A partnership, corporation, company, or association created or organized in the United States or under the laws of the United States, • An estate (other than a foreign estate), or • A domestic trust (as defined in Regulations section 301.7701-7). Special rules for partnerships. Partnerships that conduct a trade or business in the United States are generally required to pay a withholding tax under section 1446 on any foreign partners’ share of effectively connected taxable income from such business. Further, in certain cases where a Form W-9 has not been received, the rules under section 1446 require a partnership to presume that a partner is a foreign person, and pay the section 1446 withholding tax. Therefore, if you are a U.S. person that is a partner in a partnership conducting a trade or business in the United States, provide Form W-9 to the partnership to establish your U.S. status and avoid section 1446 withholding on your share of partnership income. Cat. No. 10231X Form W-9 (Rev. 8-2013)December 5, 2023 E - 43 United States, Government Addendum to the Processing Agreement (NCR Payment Solutions) (Rev. 2020-10) NCR Confidential 1 Attachment 2 GOVERNMENT ADDENDUM TO THE PROCESSING AGREEMENT This Government Addendum to the Processing Agreement (this “Addendum”) modifies the Merchant Card Processing Terms & Conditions to the Merchant Application and Agreement between NCR Payment Solutions, LLC (“NCR”) signed by City of Port Angeles (“Merchant”) (the “Processing Agreement”). To the extent any provisions of this Addendum are inconsistent with the terms and conditions of the Processing Agreement, the provisions of this Addendum will prevail. All terms used but not defined herein shall have the meanings ascribed to them in the Processing Agreement. In consideration of the mutual promises and covenants contained herein, the receipt and sufficiency of which are hereby acknowledged, the parties agree to amend the Processing Agreement as follows: 1. Section 4.1 is hereby deleted in its entirety and replaced with the following: “4.1. This Agreement shall go into effect for a 3-year term (the “Initial Term”) commencing on the date this Agreement is accepted by Processor and Bank, whether by signature or by the processing of presented Transactions. Thereafter, the Agreement will renew automatically for successive 1-year periods (the “Renewal Term”) unless either party provides written notice of non-renewal to the other at least 60 days prior to the expiration of the applicable term. If Merchant presents and Processor and Bank elects to process Transactions beyond the conclusion of the Initial Term or any Renewal Term, then the terms of this Agreement will continue to govern such processing activity.” 2. Section 5 is hereby deleted in its entirety and replaced with the following: “5. During the Initial Term or any Renewal Term, Merchant shall not receive services, or enter into an agreement to receive services, from any other entity similar to those Services that Merchant has elected to receive from Processor for the Payment Types listed in Schedule A without Processor’s express written approval and consent.” 3. Section 14 is hereby deleted in its entirety and replaced with the following: “14. Merchant is responsible for any and all claims, demands, damages, judgments, liability assessments, fines, penalties, costs, and expenses (including reasonable attorneys’ fees) suffered or incurred by Processor or Bank arising out of or relating to: (i) Merchant’s acts or omissions, or those of its employees, consultants, contractors, agents, officers, and directors, whether or not those acts or omissions were authorized by Merchant; (ii) Merchant’s Transactions or use of the Services (including, without limitation, for refunds, Chargebacks, or liability assessments imposed by the Payment Networks); (iii) Merchant’s violation of Applicable Law or Operating Rules; (iv) the state or configuration of Merchant’s equipment, including, without limitation, Merchant’s failure to maintain all point of sale equipment, download equipment, and point of sale software updates or to use EMV enabled equipment supported by Processor and/or Bank.; (v) Merchant’s use of third-party services or service providers, including gateways, value added resellers, and independent software vendors; (vi) any proceeding, litigation, or arbitration commenced by a third party arising out of or relating to any actual or alleged act or omission by Merchant; and/or (vii) any demands, investigations, or subpoenas (or similar process) received related to Merchant or its Transactions, whether initiated by regulators, law enforcement, civil litigants, or lienholders under the Uniform Commercial Code.” December 5, 2023 E - 44 United States, Government Addendum to the Processing Agreement (NCR Payment Solutions) (Rev. 2020-10) NCR Confidential 2 4. The following new Sections 24.8 and 24.9 are hereby added: “24.8 “Merchant Confidential Information” means information and materials first disclosed through written or electronic means by Merchant to Processor in connection with this Agreement, and which is either clearly identified as confidential when disclosed or is of a nature such that Processor knows or should know it to be confidential. Merchant Confidential Information does not include information that: (a) was possessed or known by Processor without any confidentiality obligations prior to receipt under this Agreement; (b) becomes publicly available through no act or omission of Processor; (c) is furnished to Processor by a third party where Processor does not know and reasonably does not believe it to be subject to use or disclosure restrictions; or (d) is independently developed by or for Processor without breach of this Agreement. 24.9 For a period of two years from the date of first disclosure, and notwithstanding termination of this Agreement, Processor will: (a) exercise the same degree of care in protecting Merchant Confidential Information as it uses to protect its own confidential information of a similar nature, but in no event less than reasonable care; and (b) except as provided under Section 24.6, not disclose Merchant Confidential Information to any person, except to those of its Affiliates, and its and their employees and contractors, who have a legitimate need to know it, and who are obligated to protect any disclosed Merchant Confidential Information under terms no less protective than those contained in this Section.” 5. Section 27.1 is hereby deleted in its entirety and replaced with the following: “27.1. All disputes or controversies of any nature whatsoever (whether in contract, tort, or otherwise) arising out of, relating to, or in connection with (a) this Agreement, (b) the relationships which result from this Agreement, or (c) the validity, scope, interpretation, or enforceability of the choice of law and venue provisions of this Agreement shall be governed by and construed in accordance with the laws of the State of Washington without giving effect to any choice or conflict of law provision or rule (whether of the State of Washington or any other jurisdiction) that would cause the application of the laws of any jurisdiction other than the State of Washington. 6. All references to “indemnified losses” in the Processing Agreement are hereby deleted. Except as modified by this Addendum, the Services are provided subject to the terms and conditions of the Processing Agreement. This Addendum and the Processing Agreement constitute the entire agreement between the parties with respect to the Services. Any modifications hereto shall be in writing and executed by the party to be bound thereby. [SIGNATURES ON FOLLOWING PAGE] December 5, 2023 E - 45 United States, Government Addendum to the Processing Agreement (NCR Payment Solutions) (Rev. 2020-10) NCR Confidential 3 Agreed and accepted by: “Merchant” “NCR” By: By: Signature Signature Printed Name Printed Name Title Title December 5, 2023 E - 46 Date: December 5, 2023 To: City Council From: Derrell Sharp, Fire Chief Subject: Reciprocal Fire Protection Act Agreement Background / Analysis: Olympic National Park has multiple facilities that reside within the City of Port Angeles including the Olympic National Park Visitor Center at 3002 Mount Angeles Road, Olympic National Park Headquarters at 600 East Park Avenue as well as portions of Hurricane Ridge Road. This agreement is entered into and authorized under RCW 39.34, the Washington State Interlocal Cooperation Act, which provides the authority to the Department to enter into agreements with other agencies of government for services. Both agencies recognize that they have resources that can be mutually shared for the protection of life and property within their respective jurisdictions. This agreement shall extend through December 31st, 2028, unless terminated earlier by one of the Parties. The Fire Chief and the City Attorney’s Office have both reviewed the agreement. Funding: There is no cost to the city associated with this agreement. The Department and the Park will provide its services at no charge to each other. Attachments: Reciprocal Fire Protection Act Agreement G8075241003 Summary: This Reciprocal Fire Protection Act Agreement is entered into by the U.S. Department of the Interior, National Park Service, Olympic National Park and Port Angeles Fire Department. The purpose of this agreement is to establish the terms and conditions und er which the Department and the Park will provide reciprocal fire protection, emergency rescue and cooperative assistance to areas within their respective jurisdictions. The current cooperative agreement has expired. Funding: There is no cost to the city associated with this agreement. The Department and the Park will provide its services at no charge to each other. Recommendation: Approve attached Reciprocal Fire Protection Act Agreement with the United States Department of Interior, National Park Service and Olympic National Park for the provision of emergency services including, but not limited to, structural fire response, wildland fire control, emergency rescue and cooperative assistance and authorize the City Manager and Fire Chief to sign the agreement. December 5, 2023 E - 47 RECIPROCAL FIRE PROTECTION ACT AGREEMENT G8075241003 between the UNITED STATES DEPARTMENT OF THE INTERIOR NATIONAL PARK SERVICE OLYMPIC NATIONAL PARK and the PORT ANGELES FIRE DEPARTMENT This Reciprocal Fire Protection Act Agreement (Agreement) is entered into by the U.S. Department of the Interior, National Park Service (NPS), Olympic National Park (Park) and Port Angeles Fire Department (Department). Throughout this agreement, the NPS and Port Angeles Fire Department may be jointly referred to as the “Parties.” The purpose of this agreement is to establish the terms and conditions under which the Department and the Park will provide reciprocal fire protection, emergency rescue and cooperative assistance to areas within their respective jurisdictions. ARTICLE I – BACKGROUND AND OBJECTIVES This Agreement is made with the recognition that the Parties each have resources and facilities that can be mutually shared to protect life and property and to provide emergency services to the public including, but not limited to, structural fire, wildland fire control, emergency rescue and cooperative assistance. ARTICLE II – LEGAL AUTHORITY For the NPS: NPS enters into this Agreement pursuant to: A. Reciprocal Fire Protection Act of May 27, 1955 (69 Stat. 66; 42 U.S.C. 1856a) (a) Each agency head charged with the duty of providing fire protection for any property of the United States is authorized to enter into a reciprocal agreement, with any fire organization maintaining fire protection facilities in the vicinity of such property, for mutual aid in furnishing fire protection for such property and for other property for which such organization normally provides fire protection. Each such agreement shall include a waiver by each party of all claims against every other party for compensation for any loss, damage, personal injury, or death occurring in consequence of the performance of such agreement. Any such agreement may provide for the reimbursement of any party for all or any part of the cost incurred by such party in furnishing fire protection for or on behalf of any other party. December 5, 2023 E - 48 B. 54 U.S.C. § 102711 which states “to facilitate the administration of the System, the Secretary may use applicable appropriations for the System to render emergency rescue, firefighting, and cooperative assistance to nearby law enforcement and fire prevention agencies and for related purposes outside the System.” For the Department: This Agreement is entered into and authorized under RCW 39.34, the Washington State Inter- local Cooperation Act, which provides the authority to the Department to enter into agreements with other agencies of government for services. ARTICLE III – STATEMENT OF WORK This Agreement sets forth the types of assistance the Parties intend to provide each other. A. The Department intends to: a. Provide the Park the opportunity to train jointly with Fire/Rescue and Medical staff of the Department on rescue techniques and emergency medical practices. b. Provide structural fire, rescue services, emergency medical and emergency medical transportation services when requested by the Park; when dispatched by 911 PENCOM (Peninsula Communications); or upon special request, provided resources are available to respond. c. The Department shall establish run cards for response areas within ONP including the Olympic National Park Visitor Center at 3002 Mt. Angeles Road, all buildings and facilities at Olympic National Park Headquarters at 600 East Park Ave and portions of Hurricane Ridge Road that lie within the city limits. d. Provide services limited to areas of the Park that are road accessible or near to road (~1 mile). The Department’s services will not include backcountry search and rescue operations unless agreed upon on a case-by-case basis by Department and Park Management in advance of deployment of resources. e. Coordinate fire response with the Park in instances where both structural and wildland responses may be needed. f. Supervise all aspects of interior structural fire suppression activities outside the Park and, upon request from the Park, supervise such activities inside the Park. g. Attempt to provide personnel, if qualified and available, to fill positions on an incident management team upon request from the park. Upon request from the Park, the Department may also make personnel available to serve in an interagency response to any National Response and/or mobilization of supplemental fire department resources for emergency or planned all-risk incidents. h. Emergency medical services and emergency medical transportation may be billed, at the discretion of the Fire Department, to those persons receiving the services and transportation. December 5, 2023 E - 49 B. NPS intends to: a. Provide the Department the opportunity to train jointly with Fire, Emergency, and Law Enforcement staff of the Park on fire protection, rescue operations, emergency medical services and incident management functions. b. Make the Department its first contact to respond to structural fire and emergency medical services, in the areas that are road accessible or near to a roadway (~1 mile) within the Port Angeles city limits. c. Assist in the development of run cards for dispatching emergency resources based on type of emergency and kind of resource necessary. d. Provide, if requested, qualified personnel, equipment, and resources to assist the Department in EMS and rescue operations near Park boundaries. e. Provide the Department with an annual familiarization tour of the Park’s facilities, equipment, and access points, maps and the parks structural fire management plan, if requested. f. Notify the Department of any changes to access effecting their response areas (i.e., road closures, new gates, etc.) and work with the Department to facilitate emergency access (i.e., keys, lock boxes, etc.) g. Provide access through NPS gates by allowing Department to hold a key for each gate. h. Attempt to provide personnel, if qualified and available, to fill positions on an incident management team upon request. NPS personnel may be made available to serve in an interagency response to any National Response and/or mobilization of supplemental resources for emergency or planned all-risk incidents. C. The Department and NPS, jointly intend: a. To provide opportunities to train jointly between NPS and Department staff on rescue techniques and emergency medical skills. b. To participate in formal and/or informal After-Action Reviews following incidents with fatalities, close-calls, responder injuries, or when requested by on-scene command or NPS/Department leadership. c. That the Parties will have the primary interest of protection of persons and property within their own jurisdiction and, accordingly, will not assume any responsibility or liability in not providing resources to the other party of this Agreement. d. Initiate requests for assistance through emergency dispatch by PENCOM, or by key officials and their designees of the requesting agency/party directly to key officials and their designees of the requested agency/party via radio, telephone, or in person. e. To use only Minimum Impact Suppression Tactics when fighting fires on any Park- managed lands. This includes, using no ground-disturbing equipment such as graders or bulldozers on Park -managed lands without the permission of the Park Superintendent or his/her designee. f. To immediately notify the other party of a fire’s discovery. g. That either party may take immediate action to suppress a fire on property under the jurisdiction of the other party. December 5, 2023 E - 50 h. That because of the limited number of qualified firefighters and/or equipment, there may be instances when response may be limited or impossible. i. That the requesting agency/party shall have command and control of the incident scene. Change of command will only be performed and authorized with the mutual agreement of all parties on the scene, and in accordance with Incident Command System. When an accident involving equipment or personnel of a responding Party occurs, the requesting Party shall immediately notify the jurisdictional and responding parties. As soon as practical, the requesting Party shall initiate an investigation of the accident. The investigation shall be conducted by a team made up of representatives from Parties, as appropriate. j. To allow the use of Department/Park radio frequencies when a supporting party is assisting the protecting party during emergency incidents, training or as requested during day-to-day operations. k. To follow all applicable laws governing disclosure of records or information gathered pursuant to this agreement, particularly those containing personally identifying information about individuals. l. Upon request and to the full extent permitted by applicable law, the Parties will share with each other final reports of incidents involving both parties. ARTICLE IV – TERM OF AGREEMENT This Agreement shall become effective on December 1, 2023 and extend through December 31, 2028, unless it is terminated earlier by one of the Parties pursuant to Article VII that follows. ARTICLE V – KEY OFFICIALS A. Key officials are essential to ensure maximum coordination and communications between the Parties and the work being performed. They are: 1. For the NPS: a. Signatory: Regional Director National Park Service Interior Regions 8, 9, 10, and 12 b. Key Official: Fire Management Officer Olympic National Park 600 East Park Avenue Port Angeles, WA 98362 Chief Ranger Olympic National Park December 5, 2023 E - 51 600 East Park Avenue Port Angeles, WA 98362 2. For the Department: a. Signatory: Nathan West City Manager City of Port Angeles b. Signatory and Key Official: Derrell Sharp Fire Chief Port Angeles Fire Department 102 East 5th Street Port Angeles, WA 98362 Telephone: 360-417-4651 Email: dsharp@cityofpa.us B. Communications. The Parties shall address any communication regarding this Agreement to the Key Officials. C. Changes in Key Officials. No party may make any permanent change in a Key Official without written notice to the other party reasonably in advance of the proposed change. The notice will include a justification with sufficient detail to permit evaluation of the impact of such a change on the scope of work specified within this Agreement. Any permanent change in Key Officials will be made only by modification to this Agreement. In the event the proposed new Key Official is not acceptable to the non-proposing party, this Agreement shall be subject to termination pursuant to Article VII that follows. ARTICLE VI – FUNDING AND PAYMENT The Department and the Park will provide its services at no charge to each other. ARTICLE VII – MODIFICATION AND TERMINATION A. This Agreement may be modified only by a written instrument executed by the Parties. B. Any party may terminate their partnership in this Agreement by providing the other party’s Key Official with 30 days advance written notice. In the event that one party provides the other with notice of its intention to terminate, the Parties will meet promptly to discuss the reasons for the notice and try to resolve their differences. ARTICLE VIII – MUTUAL WAIVER OF LIABILITY AND AGREEMENT NOT TO SEEK REIMBURSEMENT December 5, 2023 E - 52 As required by the Reciprocal Fire Protection Act of May 27, 1955, NPS and Department shall waive all claims against the other party for compensation for any loss, damage, personal injury, or death occurring in consequence of the performance of this Agreement, except that this waiver shall not apply to intentional torts or acts of violence against such persons or property. The Parties also agree not to seek reimbursement for any or all of the costs incurred by each party in furnishing any services in carrying out this Agreement. ARTICLE IX – PROPERTY UTILIZATION Unless otherwise agreed upon in writing by the Parties, any property furnished by one party to the other will remain property of the furnishing party. Any property furnished to either party during the performance of this agreement will be used and returned in the same condition with exception to normal wear and tear. ARTICLE X – GENERAL AND SPECIAL PROVISIONS A. General Provisions 1. Non-Discrimination. All activities pursuant to this Agreement shall be in compliance with the requirements of Executive Order 11246, as amended; Title VI of the Civil Rights Act of 1964, as amended, (78 Stat. 252; 42 U.S.C. §§2000d et seq.); Title V, Section 504 of the Rehabilitation Act of 1973, as amended, (87 Stat. 394; 29 U.S.C. §794); the Age Discrimination Act of 1975 (89 Stat. 728; 42 U.S.C. §§6101 et seq.); and with all other federal laws and regulations prohibiting discrimination on grounds of race, color, sexual orientation, national origin, disabilities, religion, age, or sex. 2. Lobbying Prohibition. 18 U.S.C. §1913, Lobbying with Appropriated Moneys, as amended by Public Law 107-273, Nov. 2, 2002 - No part of the money appropriated by any enactment of Congress shall, in the absence of express authorization by Congress, be used directly or indirectly to pay for any personal service, advertisement, telegram, telephone, letter, printed or written matter, or other device, intended or designed to influence in any manner a Member of Congress, a jurisdiction, or an official of any government, to favor, adopt, or oppose, by vote or otherwise, any legislation, law, ratification, policy, or appropriation, whether before or after the introduction of any bill, measure, or resolution proposing such legislation, law, ratification, policy, or appropriation; but this shall not prevent officers or employees of the United States or of its departments or agencies from communicating to any such Members or official, at his request, or to Congress or such official, through the proper official channels, requests for legislation, law, ratification, policy, or appropriations which they deem necessary for the efficient conduct of the public business, or from making any communication whose prohibition by this section might, in the opinion of the Attorney General, violate the Constitution or interfere with the conduct of foreign policy, counter-intelligence, intelligence, or national security activities. Violations of this section shall constitute violations of section 1352(a) of title 31. In addition to the above, the related restrictions December 5, 2023 E - 53 on the use of appropriated funds found in Div. F, § 402 of the Omnibus Appropriations Act of 2008 (P.L. 110-161) also apply. 3. Anti-Deficiency Act. Pursuant to 31 U.S.C. §1341 nothing contained in this Agreement shall be construed as binding the NPS to expend in any one fiscal year any sum in excess of appropriations made by Congress, for the purposes of this Agreement for that fiscal year, or other obligation for the further expenditure of money in excess of such appropriations. 4. Assignment. No part of this Agreement shall be assigned to any other party without prior written approval of the NPS and the Assignee. 5. Member of Congress. Pursuant to 41 U.S.C. § 22, no Member of Congress shall be admitted to any share or part of any contract or agreement made, entered, or adopted by or on behalf of the United States, or to any benefit to arise thereupon. 6. Agency. The Department is not an agent or representative of the United States, the Department of the Interior, NPS, or the Park, nor will the Department represent itself as such to third parties. NPS employees are not agents of the Department and will not act on behalf of the Department. 7. Non-Exclusive Agreement. This Agreement in no way restricts the Department or NPS from entering into similar agreements, or participating in similar activities or arrangements, with other public or private agencies, organizations, or individuals. 8. Survival. Any and all provisions which, by themselves or their nature, are reasonably expected to be performed after the expiration or termination of this Agreement shall survive and be enforceable after the expiration or termination of this Agreement. Any and all liabilities, actual or contingent, which have arisen during the term of and in connection with this Agreement shall survive expiration or termination of this Agreement. 9. Partial Invalidity. If any provision of this Agreement or the application thereof to any party or circumstance shall, to any extent, be held invalid or unenforceable, the remainder of this Agreement or the application of such provision to the Parties or circumstances other than those to which it is held invalid or unenforceable, shall not be affected thereby and each provision of this Agreement shall be valid and be enforced to the fullest extent permitted by law. 10. Captions and Headings. The captions, headings, article numbers and paragraph numbers appearing in this Agreement are inserted only as a matter of convenience and in no way shall be construed as defining or limiting the scope or intent of the provision of this Agreement nor in any way affecting this Agreement. 11. No Employment Relationship. This Agreement is not intended to and shall not be construed to create an employment relationship between NPS and Department or its December 5, 2023 E - 54 representatives. No representative of Department shall perform any function or make any decision properly reserved by law or policy to the Federal government. 12. No Third-Party Rights. This Agreement creates enforceable obligations between only NPS and Department. Except as expressly provided herein, it is not intended nor shall it be construed to create any right of enforcement by or any duties or obligation in favor of persons or entities not a party to this Agreement. B. Special Provisions 1. Public Information and Endorsements. a. Department shall not publicize or otherwise circulate promotional material (such as advertisements, sales brochures, press releases, speeches, still and motion pictures, articles, manuscripts or other publications) which states or implies governmental, Departmental, bureau, or government employee endorsement of a business, product, service, or position which the Department represents. No release of information relating to this Agreement may state or imply that the Government approves of the Department’s work products or considers the Department’s work product to be superior to other products or services. b. All information submitted for publication or other public releases of information regarding this project shall carry the following disclaimer: “The views and conclusions contained in this document are those of the authors and should not be interpreted as representing the opinions or policies of the U.S. Government. Mention of trade names or commercial products does not constitute their endorsement by the U.S. Government.” c. Department must obtain prior Government approval for any public information releases concerning this Agreement which refer to the Department of the Interior or any bureau or employee (by name or title). The specific text, layout photographs, etc. of the proposed release must be submitted with the request for approval. d. Department further agrees to include this provision in a sub-agreement to a subrecipient, except for a sub-agreement to a State government, a local government, or to a federally recognized Indian tribal government. 2. Publications of Results of Studies. No party will unilaterally publish a joint publication without consulting the other party. This restriction does not apply to popular publications of previously published technical matter. Publications pursuant to this Agreement may be produced independently or in collaboration with others; however, in all cases proper credit will be given to the efforts of those parties’ contribution to the publication. In the event no agreement is reached concerning the manner of publication or interpretation of results, either party may publish data after due notice and submission of the proposed manuscripts to the other. In such instances, the party publishing the data will give due credit to the cooperation but assume full responsibility for any statements on which there is a difference of opinion. December 5, 2023 E - 55 3. Rights in Data. The Department must grant the United States of America a royalty- free, non-exclusive and irrevocable license to publish, reproduce and use, and dispose of in any manner and for any purpose without limitation, and to authorize or ratify publication, reproduction or use by others, of all copyrightable material first produced or composed under this Agreement by the Department, its employees or any individual or concern specifically employed or assigned to originate and prepare such material. 4. Seat Belt Provision. In accordance with Executive Order 13043, “Increasing Seat Belt Use in the United States” (signed April 18, 1997), as amended by Executive Order 13652 (signed September 30, 2013), the Department is encouraged to adopt and enforce on-the-job seat belt use policies and programs for their employees when operating company-owned, rented, or personally owned vehicles. These measures include, but are not limited to, conducting education, awareness, and other appropriate programs for their employees about the importance of wearing seat belts and the consequences of not wearing them. ARTICLE XI – SIGNATURES IN WITNESS WHEREOF, the parties hereto have executed this Agreement on the date(s) set forth below. FOR PORT ANGELES FIRE DEPARTMENT ______________________________________ _________________ Fire Chief Date Port Angeles Fire Department ______________________________________ _________________ City Manager Date City of Port Angeles FOR THE NATIONAL PARK SERVICE ______________________________________ _________________ Randy Lavasseur Date Acting Regional Director Interior Regions 8, 9, 10, and 12 December 5, 2023 E - 56 Date: December 5, 2023 To: City Council From: Calvin W. Goings, Assistant City Manager Shannen Cartmel, Community and Economic Development Manager Subject: Resolution Updating the City’s Fee Schedule Background / Analysis: The City Council has made the development of infill, multi-household, and affordable housing a top priority for the City of Port Angeles. Over the last several years, the City has led numerous initiatives aimed at incentivizing the construction of new infill, multi-household, and affordable units. On November 8, 2023, the Council approved Ordinance 3723 adopting new permit, fire and cemetery fees, updating the fee schedule, creating reporting requirements and revising section 1.25.010 of the Port Angeles Municipal Code. This legislation will become effective on January 1, 2024. Responding to stakeholder and Council input, the proposed minor revisions to the fee schedule clarifies that non-profit and government sponsored housing projects that are eligible under the fee waiver program, are exempt from the paying the pre-application fee, and would also be exempt from the contract requirements. Funding: Not applicable. Attachments: 1. Resolution 2. Exhibit A Summary: On November 8, 2023, the Council approved Ordinance 3723 adopting new permit, fire and cemetery fees, updating the fee schedule, creating reporting requirements and revising section 1.25.010 of the Port Angeles Municipal Code. This legislation will become effective on January 1, 2024. The goal of this legislation is to further incentivize the development of infill, multi-household, and affordable housing in the City of Port Angeles. Based on Council and stakeholder feedback, Staff is recommending minor adjustments to the fee schedule to further support non-profit, and government sponsored housing initiatives. Funding: Not applicable. Recommendation: 1) Approve the resolution and 2) authorize the City Manager to make minor modifications, as necessary. December 5, 2023 E - 57 1 Attachment 1 RESOLUTION NO. __________ A RESOLUTION of the City of Port Angeles, Washington relating to fees for services; and establishing an effective date. WHEREAS, Port Angeles Municipal Code (PAMC) section 1.25.010 states that except when otherwise stated, any fee or charge due or referenced in the PAMC will be set forth in the City's fee schedule; and WHEREAS, it is in the best interest of City government to periodically update and revise its permitting fees; and WHEREAS, the attached fee schedule, Exhibit A, clarifies fees; and WHEREAS, to additionally encourage development of infill, multi-household, and affordable housing, in alignment with the policies and goals of City Council, the City provides fee waivers for certain housing projects; and WHEREAS, on September 5, 2023 the City Council of the City of Port Angeles, Washington, adopted the City of Port Angeles Master Fee Schedule (the Master Fee Schedule); WHEREAS, on November 8, 2023, the City Council of the City of Port Angeles approved Ordinance 3723 adopting new permit, fire and cemetery fees, updating the Master Fee Schedule, creating reporting requirements and revising section 1.25.010 of the Port Angeles Municipal Code. This legislation will become effective on January 1, 2024; NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Port Angeles that: 1. The Master Fee Schedule is hereby revised and updated as indicated in the attached Exhibit A to be effective on January 1, 2024. 2. Exhibit A is hereby approved and adopted. PASSED by the City Council of the City of Port Angeles at a regular meeting of said Council held on the ____ day of _________ 2023. December 5, 2023 E - 58 2 _______________________ Kate Dexter, Mayor APPROVED AS TO FORM: _____________________________ William E. Bloor, City Attorney ATTEST: _____________________________ Kari Martinez-Bailey, City Clerk December 5, 2023 E - 59 Exhibit A Fee Waivers for Permitting of Certain NEW Housing Projects 1. Fees will only be waived for developments within the City Limit of Port Angeles. 2. Types of housing eligible for this waiver: a. Developed pursuant to Port Angeles Municipal Code (PAMC) Table 17.20.020: Dwelling Units and Supportive Housing in Commercial zones, 17.21 Residential Infill Design Standards,17.22 Commercial and Multifamily Design Standards (Multifamily residential allowed uses only), or 17.46 Property Tax Exemptions for Multi-family housing; AND b. Are one of the following: i. Accessory Dwelling Unit ii. Duplex iii. Triplex iv. Fourplex v. Cottage Housing vi. Caretaker Unit vii. Apartment Complex viii. Townhomes ix. Multifamily Housing x. Group Home xi. Permanent Supportive Housing xii. Transitional Housing xiii. Emergency Housing, xiv. Adult Family Homes. xv. Low-Income Homeownership Programs (LIHP), defined as single household dwellings constructed through a recognized nonprofit, local, state, or federal self-help or sweat equity program whereby labor participation is required, and whose income at eligibility is 80% or below of Area Median Income (AMI) for Clallam County as published by the program regulatory body. LIHP projects shall be exempt from the contract and Notice-To-Title (NTT) provisions of Section 3c and 3d below. Nonprofit, local, state or federal LIHP projects shall be exempt from paying the pre-application fee for fee waiver application. 3. To qualify for the fee waiver, the Developer must: a. Submit and attend a pre-application conference with the City of Port Angeles. The applicant will pay the pre-application fee. If the project is deemed applicable and approved for the fee waiver, the applicant will be reimbursed the pre-application fee at the time of building permit approval. b. Submit to Community and Economic Development (CED) a complete Permit Fee Waiver Application on a form provided by CED. c. Enter into a contract with the City of Port Angeles, agreeing that the unit(s) will not be used for any Short-Term Rental, Bed and Breakfast, Hotel, Motel, or any similar Lodging Type Use, and on such other terms and conditions as directed by CED. d. Execute a Notice-to-Title (NTT) to be filed with the Clallam County Auditor’s Office at the expense of the owner/applicant. The NTT will be valid for 10 years. December 5, 2023 E - 60 Date: December 5, 2023 To: City Council From: Mike Healy, Director of Public Works & Utilities Subject: Declaration of Emergency – Viewing Tower at City Pier Background / Analysis: On November 21, 2023, a Declaration of Emergency was issued by the City Manager, immediately closing portions of the City Pier, the Viewing Tower, and surrounding areas due to significant structural failures reported by Sargent Engineers. A press release was issued relative to this closure and remains available on our website at the following link: https://cityofpa.us/CivicAlerts.aspx?AID=1533 The City contracted with Sargent Engineers to perform a maintenance inspection of City Pier Viewing Tower. Sargent Engineers reported discovery of significant structural failures in and around the Viewing Tower as to create the potential of the imminent collapse of the Viewing Tower. Due to the severity of the structural defects and possible collapse, an emergency is present. Funding Overview: TBD Summary: The purpose of this memo is to approve and ratify the Viewing Tower at City Pier Declaration of Emergency issued by the City Manager on November 21, 2023. Funding: TBD Recommendation: Approve and ratify the Declaration of Emergency signed by the City Manager on November 21, 2023. December 5, 2023 E - 61 RESOLUTION NO. A RESOLUTION of the City Council of the City of Port Angeles, Washington, affirming and ratifying the Declaration of Emergency issued by the City Manager on November 21, 2023. WHEREAS, a Declaration of Emergency was issued by the City Manager on November 21, 2023, a complete copy of which is attached; and WHEREAS, the Council has reviewed the facts and circumstances that prompted the Declaration of Emergency; and WHEREAS, the Council hereby finds that the facts recited in the Declaration are true and correct. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Port Angeles: 1. The Council finds and declares that the structural defects and possible collapse of the Viewing Tower on the City Pier discovered on November 9, 2023, constituted an emergency in the City of Port Angeles; and 2. The City Council approves, affirms, and ratifies (1) the Declaration of Emergency issued by the City Manager on November 21, 2023, (2) all actions taken and contracts make under the authority of that Declaration, and (3) the authorities declared in the Declaration to take such additional actions and make other contracts as needed to respond to the continuing emergency created by structural defects and possible collapse of the Viewing Tower on the City Pier. PASSED by the City Council of the City of Port Angeles at a regular meeting of said Council held on the 5th day of December 2023. _______________________________ Kate Dexter, Mayor ATTEST: _______________________________ Kari Martinez-Bailey, City Clerk APPROVED AS TO FORM: December 5, 2023 E - 62 _______________________________ William E. Bloor, City Attorney December 5, 2023 E - 63 CITY OF PORT ANGELES DECLARATION OF EMERGENCY Viewing Tower at City Pier. Nathan A. West, City Manager of the City of Port Angeles, finds that the following facts exist: 1. Earlier this year, the City contracted Sargent Engineers to perform a maintenance inspection of City Pier Observation Tower. On November 9, Sargent reported discovery of significant structural failures in and around the Viewing Tower. The structural failures are reported to be so significant as to create the potential of the imminent collapse of the Viewing Tower. This creates a serious risk to public safety and the safety of surrounding property. 2. These facts create a situation that, for protection of public safety and of property, portions of City Pier and the Viewing Tower and surrounding area must be closed immediately and remain closed until the Viewing Tower can be restored to a safe and secure condition 3. Repairing the Viewing Tower will require the expertise of a structural engineer. The City does not have a structural engineer on staff. It will be imperative to contract with one to determine an appropriate long-term remedy for the Viewing Tower. 4. City Pier and the Viewing Tower are central features of the Port Angeles community. The inability to readily access them is a significant and costly disruption to this community. To prevent substantial economic loss, to protect public safety, to prevent property damage, it is essential that safe and secure access to City Pier and the Viewing Tower be restored as soon as possible. 5. Due to the severity of the structural defects and possible collapse of the Viewing Tower, its impact on the City's economy, its central role in community life, and the need for immediate repair, an emergency is present which may necessitate utilization of emergency powers granted pursuant to RCW 35.33.081 and RCW 38.52.070(2). Now, therefore, by the authority granted to me under State law and by the City Council, I hereby declare that an emergency exists in Port Angeles due to the structural defects and potential collapse of the City Pier Tower and that the City is authorized to do the following: 1. Close City Pier to the extent necessary to protect public safety and the safety of surrounding property; and 2. Enter into contracts and incur obligations necessary to remedy the conditions that are creating this emergency situation; and 3. Authorize and implement all measures and acts deemed prudent to protect the health and safety of persons and the preservation of property; and 4. Make purchases, enter contracts, direct staff actions as needed, and take all other actions and measures as may be necessary to respond to potential imminent collapse of the Viewing Tower; and 5. Each City Department is authorized to exercise the powers authorized and vested under this Declaration resolution in light of the emergency situation without regard to time-consuming procedures and formalities prescribed by law (excepting mandatory constitutional requirements). 6. This Declaration shall be presented to the City Council at its regular meeting on December 5, 2023, for consultation and ratification. DATED this 21 st day of November 2023. Nathan A. West, City Manager Date: December 5, 2023 To: City Council From: Nathan A. West, City Manager William Bloor, City Attorney Subject: Lease Agreement Between the City and Lower Elwha Klallam Tribe for Use of the Carnegie Library Building Background / Analysis: The City of Port Angeles (“City”) owns the building located at 205 S. Lincoln Street, Port Angeles, which is known as the Carnegie Library (“Building”). In 2003 the City entered into a twenty (20) year Lease Agreement (“Lease 1”) with the Clallam County Historical Society (“Society”) to operate a “historical museum and gift shop for the express purpose of preserving and promoting the heritage and culture of Port Angeles and Clallam County” within the Building. In 2016 the Lease was amended to assign the rights and responsibilities granted to Society to the Lower Elwha Klallam Tribe (“Tribe”), whereby the Tribe assumed the responsibilities of the Society. The 20-year term of Lease 1 will expire on December 31, 2023. The City and Tribe have negotiated a new Lease Agreement (“Lease 2”). Lease 2 between the City and the Tribe is substantially similar to Lease 1 and the 2016 amendment. The Tribe “intends to continue to operate the building as a Tribal History Museum, open to the public; [and] should the building cease to be used as [such], the City reserves the right to begin the termination process.” Further, “at its option, the Tribe may utilize some or all of the building as Tribal government offices.” The term of Lease 2 is for an additional 20 years, terminating on December 31, 2044, with the option of renewing it for 3 additional 10- year periods, provided, the Tribe and City mutually agree to such extensions in writing. The Tribe agrees to pay one dollar ($1.00) per month as rent, along with other valuable consideration to the City which is associated with running a public museum. Although the monetary amount of rent in relatively small, the City receives substantial value from this lease agreement. The Tribe has a demonstrated record of maintaining properties in very good condition, and the Tribe in this lease takes responsibility for general maintenance and upkeep of the property. Additionally, the $1.00 amount is the same amount charged the Tribe in 2016. Both then and now, the Council has found that a substantial benefit to the community is created by the purposes served by this lease. Both the 2003 and the 2023 agreements list as consideration “the benefit to the general public from the enhancement of the economic and historical environment of the City of Port Angeles to be realized by the performance of this agreement…” Summary: The City owns the building located at 205 S. Lincoln Street, which is known as the Carnegie Library. Since 2016 the City has leased the Carnegie Library to the Lower Elwha Klallam Tribe for the Tribe’s use as a Tribal History Museum and Tribal government offices. The current lease will expire at the end of 2023. The purpose of this Council action is to renew the Carnegie Building lease with the Tribe for a period of twenty (20) years with the option of three (3) additional (10) year renewals. Funding: No cost to the City. Recommendation: Approve the Carnegie Building Lease for the use of the Lower Elwha Klallam Tribe and authorize the City Manager to make minor modifications to the Lease Agreement as necessary. December 5, 2023 E - 64 Tribal Chair, Francis Charles signed Lease 2 on behalf of the Tribe on November 7, 2023. Staff requests the Council approve Lease 2 and authorize the City Manager to make minor modifications to it as necessary. Funding Overview: The Lease will have no impact on City finances other than an additional $1.00 per month and other benefits associated with the operation of a museum dedicated to important local history. Attachments: 2023 “Renewal of Commercial Premises Lease Agreement Dated 11/07, 2023” executed by Tribal Chair Francis Charles. Original 2003 “Commercial Premises Lease Agreement” with Clallam County Historical Society. 2016 “Assignment and Amendment to Commercial Premises Lease Agreement Dated October 28, 2023.” December 5, 2023 E - 65 December 5, 2023 E - 66 December 5, 2023 E - 67 December 5, 2023 E - 68 December 5, 2023 E - 69 December 5, 2023 E - 70 December 5, 2023 E - 71 December 5, 2023 E - 72 December 5, 2023 E - 73 December 5, 2023 E - 74 December 5, 2023 E - 75 Date: December 5, 2023 To: City Council From: Nathan West, City Manager Sarina Carrizosa, Finance Director Subject: Adoption of the 2024 Budget Background / Analysis: The 2024 Budget placed an emphasis on Strengthening our Foundation and Investing in Core Services. This theme was at the heart of the budgetary decisions when building the 2024 Proposed Budget and drove key concepts in the budget including: ▪Enhancing the customer service experience by moving the temporary positions originally funded from the American Rescue Plan Act (ARPA) including the Communication and Records Coordinator, Front Desk Attendant, Project Manager and Housing Administrator into the budget permanently. Additionally, the Permit Technician position was further stabilized in the 2024 Budget by including a dedicated funding source for this position. ▪Additionally, to enhance our commitment to our community, permit fee waivers have been included in the budget and performance measurements will be set into place. ▪Increasing the safety of our local community was achieved through continued support of the Community Paramedicine program and the Downtown Resource Officer position created early in 2023. In addition, Council approved the use of the $1.8 million opioid settlement for Operation Shielding Hope that will provide solutions to our community that have been impacted by the opioid crisis. ▪Promoting environmental resilience has been demonstrated through the purchase of the City’s first fully electric vehicles, the inclusion of positions that will promote, protect Summary: One of the most important Council decisions each year is the approval of the annual budget. The budget process is extensive and begins in March of each year with the Capital Facilities Plan & Transportation Improvement Plan (CFP & TIP). A key component is public input. The City of Port Angeles is required by RCW 35A.33.070 to hold a public hearing on the budget. The 2024 Budget has been available for citizen review since October 6, 2023. There was also a Revenue Sources presentation and Public Hearing on October 17th as well as a work session regarding the 2024 Budget on October 24, 2023. This is the second reading of the ordinance adopting the 2024 Budget. Funding: The 2024 Citywide Budget is set at $178,350,500 and is balanced. Recommendation: It is recommended tonight that the City Council should: 1.Continue the Public Hearing from the November 21st Council meeting; and 2.Conduct the second reading of 2024 Budget Ordinance; and 3.Adopt the ordinance. December 5, 2023 F - 1 and enhance our climate such as an additional Utility Worker in the Stormwater fund and a Natural Resources Planner. Additionally, the 2024 Budget includes funding to support the updates to the Comprehensive Plan and Climate Resilience Plan and increased conservation efforts. ▪ The Proposed 2024 Budget includes $42.6 million in investments to the City’s infrastructure. Additionally, the 2024 Budget includes capacity to move these projects forward in a timely manner, this includes the addition of several essential positions such as a Capital Projects Inspector, City Electrician and a Grant Coordinator. These positions will not only allow the City to complete capital projects but will also promote the ability to utilize funding sources that will enable projects to move forward that would have otherwise remained unfunded. The approval of the annual budget each year is one of the most important decisions City Council makes. The budget process is extensive and incorporates Council guidance throughout the year from the Strategic Plan, Comprehensive Plan, Climate Action Plan and the Capital Facilities Plan & Transportation Improvement Plan (CFP & TIP). In addition, to help prepare for the budget development and review process, a number of workshops and information have been conducted and provided to Council that focused on both the status of the 2023 Budget, including Budget Amendments #1 and #2, and the issues facing the City in the development of the 2024 City Manager Recommended Budget including the Budget Goals work session in July, the Capital Facilities Plan and Transportation Improvement Plan process and work sessions where Council identified additional revenue options that may be utilized to balance the budget. The ability to utilize the Council selected revenue options was critical to balancing the City’s 2024 budget and allowed the City’s financial foundation to remain stable while continuing to meet the needs of our community. Of the six revenue sources selected by Council two were incorporated into the 2024 Proposed Budget, an increase of 0.1% to Transportation Benefit District tax collection and updates to the City’s permit, cemetery and fire fees. The four remaining items, vacant property fees, short-term rental fees, a 0.1% increase to the countywide 911 tax and a border area fuel tax, will continue to be carefully considered and balanced with the City’s budgetary needs and affordability of the Port Angeles community. It is with these additional sources that the City will implement new growth, capacity and maintain programs and services within the budget. Additionally, a key component to the budget process is public input. The City of Port Angeles is required by RCW 35A.33.070 to hold a public hearing on the budget. Tonight’s meeting will include an opportunity for public input on the planned 2024 Budget. State law also requires that the City Manager provide a balanced budget for Council review no later than November 1st of each fiscal (calendar) year. The 2024 Budget was delivered to Council and posted to the City website on October 6, 2023. Finally, since the presentation of the 2024 Preliminary Budget on October 24th there have been a few minor changes to the final budget presented tonight. The first change is the movement of unfinished capital projects from the 2023 Budget into the 2024 Budget for completion. This is a standard process as most projects carry over multiple years and the movement prior to a budget amendment allows spending to occur seamlessly. These changes are outlined in detail in an attachment to this memo. The second item is an organizational change in the IT Department to create a Principal Systems Network Analyst position. This position will allow the IT Department to provide a more efficient response time to city-wide December 5, 2023 F - 2 information technology requests, and in recognition of the increased workload in the Information Technology Department that has occurred over the last few years, this new job classification will be added to the Systems Network Analyst and Senior Systems Network Analyst job classification progression on the AFSCME salary schedule. This change is not an addition to the City’s overall personnel budget and would not result in an increase to expenses planned in 2024. Finally, several other position and classification revisions have been made to reflect the 2024 Budget. Staff is requesting that City Council continue the Public Hearing on the 2024 City Manager Recommended Budget from the November 21st meeting to allow for additional public input, conduct the second reading of the ordinance adopting the 2024 Budget and adopt the ordinance. Funding Overview: The 2024 Citywide Budget is set at $178,350,500 and is balanced. Attached: List of Changes for the 2024 Final Budget. 2024 Budget Ordinance. Exhibit A – Fund Summary. December 5, 2023 F - 3 REVENUE EXPENSE CHANGES FOR FINAL BUDGET 310 8985 594 6510 - 288,600 Defer GG1113; Facility Security Projects/City Hall Cameras into 2024 310 8985 594 6510 - 220,000 Defer PK0122; Erickson Playfield Tennis into 2024 310 8985 594 6510 - 30,000 Defer PK0123; Elks Pickleball Court Improvements into 2024 310 8985 594 6510 - 103,000 Defer PK0205; Restroom Replacement Program into 2024 310 8985 594 6510 - 50,000 Defer PK0316; Locomotive #4 Refurbishment into 2024 310 8985 594 6510 - 532,100 Defer PK0719; Parks Maintenance Building into 2024 TOTAL CAPITAL IMPROVEME - 1,223,700 312 7930 595 6510 - 48,900 Defer TR0101; Laurel Street Stairs into 2024 312 7930 595 6510 - 550,000 Defer TR0115; N St Chip Seal (5th to 18th Streets)into 2024 312 7930 595 6510 - 200,000 Defer TR0121; Pavement Management Plan into 2024 312 7930 595 6510 - 170,000 Defer TR0222; First/Front Pedestrian Enhancements into 2024 312 7930 595 6510 - 30,000 Defer TR0321; Speed Feedback Sign Program into 2024 312 7930 595 6510 - 317,200 Defer TR0414; Peabody Creek/Lincoln Street into 2024 312 7930 595 6510 - 1,154,900 Defer TR0405 ~ Street and Alley Paving into 2024 312 7930 595 6510 - 9,700 Defer TR0416; Green Alleys 1st/2nd/Valley/Oak into 2024 312 7930 595 6510 - 400,000 Defer TR0420; 2023 Pavement Preservation into 2024 312 7930 595 6510 - 250,000 Defer TR0619; Race Street Complete Construction Phase II into 2024 312 7930 595 6510 - 30,400 Defer TR0715; 16th St LID (C-L) into 2024 312 7930 595 6510 - 20,000 Defer TR0716; ADA - Peabody Creekinto 2024 312 7930 595 6510 - 495,000 Defer TR0918; Downtown Tree/Sidewalk Replacement Phase III into 2024 312 7930 595 6510 - 120,000 Defer TR1118; Revolving Street Improvements into 2024 312 7930 595 6510 - 1,115,500 Defer TR1215; City Hall East Parking lot into 2024 312 7930 595 6510 - 84,200 Defer TR1799; Truck Route and Hiway 101 Intersection into 2024 TOTAL TRANSPORTATION BE - 4,995,800 451 7188 594 6510 - 175,000 Defer CL0216; City/PUD Agreement (Svc Area)into 2024 451 7188 594 6510 - 345,000 Defer CL0217; I Street Substation Switchgear Replacementinto 2024 451 7188 594 6510 - 1,300,000 Defer CL0414; Light Ops Building into 2024 451 7188 594 6510 - 175,000 Defer CL0420; College St LTC Load Tap Changer Replacement into 2024 TOTAL ELECTRIC CAPITAL FUN - 1,995,000 452 7388 594 6510 - 120,000 Defer WT0121; White Creek & 3rd St Crossing Main into 2024 452 7388 594 6510 - 349,000 Defer WT0122; Elwha - Fish Screen Facility Improvements into 2024 452 7388 594 6510 - 60,000 Defer WT0123; 11th Street ROW Tumwater Creek Crossing into 2024 452 7388 594 6510 - 60,000 Defer WT0223; 14th Street ROW Tumwater Creek Crossing into 2024 452 7388 594 6510 - 200,400 Defer WT0218; Reservoir Instrumentation Upgrades into 2024 452 7388 594 6510 - 152,000 Defer WT0222; Elwha - Effluent Distribution Structure Bypass into 2024 452 7388 594 6510 - 440,000 Defer WT0320; Morse Creek Transmission Main Eval/Design into 2024 452 7388 594 6510 - 150,000 Defer WT0519; Water Treatment Plant Repairs into 2024 452 7388 594 6510 - 81,400 Defer WT0619; Peabody Reservoir inlet pipe replacement into 2024 TOTAL WATER CAPITAL FUND - 1,612,800 453 7488 594 6510 - 250,900 Defer WW0122; Anaerobic Digester Roof Improvements into 2024 453 7488 594 6510 - 1,202,700 Defer WW0220; West 4th St Capacity Improvement into 2024 453 7488 594 6510 - 40,900 Defer WW0419; WWTP HVAC Replacement into 2024 453 7488 594 6510 - 22,000 Defer WW0320; WWTP Septic Truck Pad Repair into 2024 TOTAL WASTEWATER CAPITA - 1,516,500 2024 BUDGET - CHANGES FOR FINAL ACCOUNT December 5, 2023 F - 4 454 7588 594 6510 - 110,000 Defer SW0122; Landfill Automated Facility Gate into 2024 TOTAL SOLID WASTE CAPITA - 110,000 456 7688 594 6510 - 102,000 Defer DR0213; H Street Outfall Improvements into 2024 456 7688 594 6510 - 40,000 Defer DR0215; Francis Street Outfall into 2024 456 7688 594 6510 - 198,000 Defer DR0322; Park Ave. Outfall to Peabody Creek into 2024 456 7688 594 6510 - 40,000 Defer DR0804; Lincoln Park Big Boy Pond Study into 2024 TOTAL STORMWATER CAPITA - 380,000 463 7489 594 6510 - 15,000 Defer WW0316; CSO 6 & 7 into 2024 TOTAL CSO CAPITAL FUND - 15,000 501 7630 594 6410 - 39,900 Defer #194 GMC Sonoma Pick-up (Finance) into 2024 501 7630 594 6410 - 53,500 Defer #1310- Ford Crown Victoria (Police) into 2024 501 7630 594 6410 - 53,500 Defer #1311- Chevrolet Caprice (Police) into 2024 501 7630 594 6410 - 53,600 Defer #6101- Chevrolet Colorado 4X4 Volunteer (Police) into 2024 501 7630 594 6410 - 985,000 Defer #3 Pierce Pumper (Fire) into 2024 501 7630 594 6410 - 47,200 Defer #2020 2001 Ford Explorer (Fire) into 2024 501 7630 594 6410 - 100,600 Defer #4328 GMC Sierra 3500 Flat Bed (Parks) into 2024 501 7630 594 6410 - 82,300 Defer #1887 Ford F450 Flatbed/Snow Plow (Parks) into 2024 501 7630 594 6410 - 50,400 Defer #4900 GMC Savanna Van (Light Ops) into 2024 501 7630 594 6410 - 40,700 Defer #133 Chevy Blazer (Light Ops) into 2024 501 7630 594 6410 - 40,700 Defer #135 Chevy Blazer (Light Ops) into 2024 501 7630 594 6410 - 275,600 Defer #1950 Freightliner/Versalift Manift (Light Ops) into 2024 501 7630 594 6410 - 31,500 Defer #148 Catepillar Forklift (Light Ops) into 2024 501 7630 594 6410 - 39,500 Defer #6702 GMC Canyon Pickup (Water) into 2024 501 7630 594 6410 - 131,400 Defer #1756 John Deere Backhoe Loader (Water) into 2024 501 7630 594 6410 - 68,300 Defer #1616 Ford F350 Service Truck (Wastewater) into 2024 501 7630 594 6410 - 58,200 Defer #4600 GMC Sierra 1500 4X4 Pick-up (Wastewater) into 2024 501 7630 594 6410 - 32,100 Defer #2184 Ecostack 503W Conveyor (Solid Waste) into 2024 501 7630 594 6410 - 375,000 Defer #1240 Freightliner Air Sweeper (Stormwater) into 2024 501 7630 594 6410 - 9,500 Defer Herb Spray Attachment (Stormwater) into 2024 501 7630 594 6410 - 30,000 Defer #1569 Catepillar WHL Loader (Equipment Services) into 2024 TOTAL EQUIPMENT SERVICES - 2,598,500 502 2082 594 6510 - 2,000,000 Defer IT0716; ERP Road Map into 2024 TOTAL IT CAPITAL FUND - 2,000,000 - 16,447,300 TOTAL ALL FUNDS December 5, 2023 F - 5 ORDINANCE NO. ____ AN ORDINANCE of the City of Port Angeles, Washington, adopting the 2024 budget for the fiscal year ending December 31, 2024. WHEREAS, the City Manager of the City of Port Angeles completed and placed on file with the City Clerk an estimate of the amount of the moneys required to meet the public expenses, reserve funds, requirements and expenses of government of the City included in the 2024 City Manager’s recommended budget for the fiscal year ending December 31, 2024, as attached hereto as Exhibit “A”; and WHEREAS, a notice was published that the City Council would hold public hearings at the hour of 6:30 p.m., in the Council Chambers of Port Angeles City Hall, on Tuesday, November 21, 2023, and Tuesday, December 5, 2023, for the purpose of making and adopting a budget for fiscal year 2024 and giving taxpayers within the limits of the City of Port Angeles an opportunity to be heard upon said budget; and WHEREAS, the City Council did meet at said times and place, did conduct public hearings, and did then consider the matter of said proposed budget, NOW, THEREFORE, the City Council of the City of Port Angeles, Washington, do ordain as follows: Section 1. The budget for the City of Port Angeles, Washington, for the year 2024 is hereby adopted at the fund level in its form and content as set forth in the document entitled “City of Port Angeles, Washington 2024, Budget,” a copy of which is on file in the Office of the City Clerk, and which is incorporated herein by this reference. December 5, 2023 F - 6 Section 2. Estimated resources for each separate fund of the City of Port Angeles, and aggregate expenditures for all such funds for the year 2024 are set forth in summary form in Exhibit A that is attached hereto, and are hereby appropriated for expenditure by fund. Section 3. The City Clerk is hereby directed to keep on file the budget referred to in Section 2 above and to transmit a complete copy of the final budget to the Division of Municipal Corporations in the Office of the State Auditor and to the Association of Washington Cities. Section 4. The City Clerk and the codifiers of this ordinance are authorized to correct scrivener’s/clerical errors, references, ordinance numbering, section/subsection numbers and any references thereto. Section 5. This Ordinance exercises authority granted exclusively to the City Council and is not subject to referendum. It shall be in force and take effect 5 (five) days after publication according to law. PASSED by the City Council of the City of Port Angeles, Washington, at a regular meeting of said Council on the ____th day of December, 2023. ______________________________ Kate Dexter, Mayor ATTEST: _______________________________ Kari Martinez-Bailey, City Clerk APPROVED AS TO FORM: _______________________________ William E. Bloor, City Attorney PUBLISHED: , 2023 By Summary December 5, 2023 F - 7 CITY of PORT ANGELES 2024 Budget Ordinance - Exhibit A Fund Div.Name / Description Beginning Revenue Expenditures Ending Balance Balance - Est. GENERAL FUND (Note: Divisional totals for reference only) Fund Balance:6,059,665 5,906,065 001.1160 City Council 69,300 101,800 001.1210 City Manager 340,500 634,900 001.1211 Customer Commitment - 2,500 001.1220 Human Resources 139,700 330,500 001.1230 City Clerk 71,100 336,300 001.2001 Finance - Revenue 16,212,400 - 001.2020 Finance Administration 223,500 1,069,400 001.2023 Accounting 833,600 1,141,700 001.2025 Customer Service 1,472,000 1,412,600 001.2070 Reprographics 39,600 46,600 001.3030 City Attorney 213,000 622,000 001.3012 Jail Contributions - 1,087,900 001.4060 Planning 459,800 919,100 001.4050 Building 711,100 280,200 001.4071 Economic Development 50,000 101,900 001.5010 Police Administration 1,000 690,200 001.5012 PenCom/Capital Transfers 431,300 677,200 001.5021 Police Investigation 1,400 1,269,100 001.5022 Police Patrol 736,000 4,518,100 001.5026 Police Reserves & Volunteers - 10,100 001.5029 Police Records 11,000 510,100 001.5050 Police Facilities Maintenance 16,100 9,200 001.6010 Fire Administration 67,700 236,900 001.6012 PenCom/Medic I Support - 350,200 001.6020 Fire Suppression - 1,574,200 001.6030 Fire Prevention 103,500 120,700 001.6045 Fire Training 3,000 121,300 001.6050 Fire Facilities Maintenance - 65,300 001.7010 Public Works Administration 1,570,400 2,644,000 001.7012 Public Works CIP - 30,000 001.7032 Public Works Telecommunications 32,800 32,800 001.8010 Parks Administration - 345,300 001.8012 Senior Center 34,000 164,800 001.8050 Ocean View Cemetery 250,000 206,700 001.8080 Park Facilities - 2,212,700 001.8112 Senior Center Facilities - 57,300 001.8131 Central Services Facilities 485,300 492,800 001.8155 Facility Rentals 78,500 118,300 001.8221 Sports Programs - - 001.9029 General Unspecified 2,091,600 2,358,100 001 TOTAL General Fund 6,059,665 26,749,200 26,902,800 5,906,065 Funds 2024 Budget December 5, 2023 F - 8 CITY of PORT ANGELES 2024 Budget Ordinance - Exhibit A SPECIAL REVENUE FUNDS 101 Lodging Excise Tax Fund 1,109,750 876,200 1,069,900 916,050 102 Street Fund 393,486 2,168,700 2,168,700 393,486 105 Real Estate Excise Tax-1 (REET-1) Fund 503,276 313,200 767,800 48,676 107 PenCom Fund 1,552,642 3,570,700 4,024,500 1,098,842 160 Real Estate Excise Tax-2 (REET-2) Fund 17,523 313,800 200,000 131,323 165 Business Improvement Area 81,671 32,900 - 114,571 172 Port Angeles Housing Rehab. Fund 2,335,720 608,500 254,700 2,689,520 175 Code Compliance Fund 56,285 254,300 254,300 56,285 TOTAL Special Revenue Funds 6,050,351 8,138,300 8,739,900 5,448,751 Fund Div.Name / Description Beginning Revenue Expenditures Ending Balance Balance - Est. DEBT SERVICE FUNDS 216 2014 LTGO Bond (Landfill Bluff Stabilization) Fund 160,192 603,200 598,800 164,592 217 2015 LTGO Bond - Refunding (W.U.G.A.)15,475 235,900 233,700 17,675 TOTAL Debt Service Funds 175,667 839,100 832,500 182,267 ENTERPRISE / UTILITY FUNDS 401 Electric Utility Fund 13,153,085 29,085,800 33,055,700 9,183,185 402 Water Utility Fund 11,645,211 7,499,400 12,784,900 6,359,711 403 Wastewater Utility Fund 2,374,407 7,678,700 9,164,700 888,407 404 Solid Waste Utility Fund (710,738)17,520,500 16,707,500 102,262 406 Stormwater Utility Fund 1,569,349 3,724,400 3,924,400 1,369,349 409 Medic 1 Utility Fund 1,163,957 3,445,400 3,738,200 871,157 413 Harbor Clean-up Fund (381,971)2,050,600 2,050,600 (381,971) 421 Conservation Fund 273,786 709,600 709,600 273,786 TOTAL Enterprise / Utility Funds 29,087,086 71,714,400 82,135,600 18,665,886 INTERNAL SERVICE FUNDS 501 Equipment Services 4,907,258 3,054,100 5,733,200 2,228,158 502 Information Technology 1,910,265 2,576,000 4,432,200 54,065 503 Self-Insurance 273,166 7,885,600 7,885,600 273,166 TOTAL Internal Service Funds 7,090,689 13,515,700 18,051,000 2,555,389 FIDUCIARY FUNDS 602 Firemen's Pension Fund 162,611 19,200 69,400 112,411 TOTAL Fiduciary Funds 162,611 19,200 69,400 112,411 PERMANENT FUNDS 601 Cemetery Endowment Fund 397,696 4,200 - 401,896 TOTAL Permanent Funds 397,696 4,200 - 401,896 Funds 2024 Budget December 5, 2023 F - 9 CITY of PORT ANGELES 2024 Budget Ordinance - Exhibit A CAPITAL FUNDS 310 Governmental Capital Improvement Fund 2,589,526 2,992,700 4,321,200 1,261,026 312 Transportation Capital 7,569,714 5,277,300 11,331,200 1,515,814 316 Governmental Park Improvement Fund 317,506 11,300 - 328,806 451 Electric Capital Fund 12,730,683 4,500,000 7,294,900 9,935,783 452 Water Capital Fund 4,476,283 2,775,000 5,175,500 2,075,783 453 Wastewater Capital Fund 2,526,275 1,007,900 2,775,600 758,575 454 Solid Waste Capital Fund 1,625,831 1,991,200 3,044,400 572,631 456 Stormwater Capital Fund 3,432,060 667,000 2,851,300 1,247,760 463 Combined Sewer Overflow Capital Fund 744,230 3,287,000 2,258,900 1,772,330 TOTAL Capital Funds 36,012,107 22,509,400 39,053,000 19,468,507 SUB-TOTAL ALL FUNDS 85,035,873 143,489,500 175,784,200 52,741,173 Reserves - Designated 2,566,300 Reserves Used 34,861,000 TOTAL CITYWIDE ALL FUNDS 85,035,873 178,350,500 178,350,500 52,741,173 December 5, 2023 F - 10 Date: December 5, 2023 To: City Council From: Nathan West, City Manager Sarina Carrizosa, Finance Director Subject: 2023 Budget Amendment #3 Background / Analysis: The 3rd Amendment will align the budget with the changes to City revenues and expenditures that occurred in the last portion of the year, including deferring projects to 2024, increasing expenditures to complete projects, and other miscellaneous budgetary changes and corrections. Most of these changes have already been approved by Council. With this amendment, the projected year-end unassigned fund balance in the General Fund is estimated to be $6,059,665, or 25.0%. Some of the individual actions require funding to come from reserves (money unspent at the end of the fiscal year automatically rolls into reserves/fund balance), approval of the ordinance will require a super majority of the entire Council, or five (5) affirmative votes. Attached is a detailed list of proposed budget changes, the budget amendment ordinance, along with Exhibit A which lists total revenues and expenditures by fund for the 2023 Budget amendment #2 and proposed amendment #3. This is the second reading of this ordinance. Since the first reading a few changes have occurred to the amendment to include items that were approved by City Council at the last two Council meetings including incorporation of grant funding in the Police department in the amount of $100,000, the inclusion of $250,000 in ARPA funding for past due utility accounts previously approved by Council and an additional increase to the overtime in the PenCom fund due to continued significant need in this fund. These have been included on the attached list of changes to this memo. Tonight’s meeting will include the second reading of the third budget amendment ordinance and adoption of the ordinance Summary: The 2023 Budget is being amended for the third and final time to adjust several funds to reflect changes in revenues and expenditures that have occurred during the final months of the year. As this budget amendment includes changes to revenues, as well as an authorization to use funds from reserves, the ordinance must be approved by a super-majority of the entire Council or at least five (5) affirmative votes. This is the second reading and adoption of this ordinance. Since the first reading there have been a few changes that resulted from Council action during the last two Council meetings. Funding: The 3rd amendment to the 2023 Budget is balanced at $153,724,900. Recommendation: It is recommended the City Council should: 1.Conduct the second reading of the 2023 Budget amendment #3 ordinance; and 2.Adopt the ordinance. December 5, 2023 G - 1 Funding Overview: The 3rd amendment to the 2023 Budget is balanced at $153,724,900. Attached: List of proposed budget changes. 2023 Budget Ordinance – Amendment #3. Exhibit A. December 5, 2023 G - 2 BUDGET AMENDMENT ITEM Revenues Expenditure Account Notes Increase Sales Tax for current collection 750,600 - 001-2001-313-11-00 Revenue Adjustment REdisCOVERY Grant (2023-2024)100,000 - 001-5010-334-04-90 Council Approved 11/08/23 REdisCOVERY Grant (2023-2024)- 100,000 001-5022-521-41-50 Council Approved 11/08/23 Bureau of Justice Grant; Body Cameras 13,700 - 001-5022-333-16-73 Grant U.S. Dept of Justice Grant - 3,000 001-5022-521-10-11 Grant U.S. Dept of Justice Grant 3,000 - 001-5022-342-10-11 Grant Opioid Settlement 37,800 - 001-2001-369-40-00 Council Approved DNR computer Grant 4,000 - 001-6020-334-02-30 Grant DNR computer Grant - 4,000 001-6020-522-31-60 Grant Room Dividers- Fire Dept - 5,000 001-6050-522-31-20 Rapid Intervention Team Training 7,700 - 001-6020-342-20-12 Grant Playground Tile Glue carried from 2022 - 85,700 001-8080-597-59-91 Council Approved ARPA Funds Reimbursements - 270,000 001-9029-518-41-50 ARPA Grant ARPA Funds Reimbursements 270,000 - 001-9029-333-21-02 ARPA Grant Utility Arrearage Program 406,800 - 001-9029-333-21-02 Grant Funding Utility Arrearage Program - 406,800 001-9029-518-49-91 Grant Funded TOTAL GENERAL FUND 1,593,600 874,500 Race Street Art Work for Project TR0209 - 40,000 101-1430-557-41-50 LTAC Approved Marketing - 25,000 101-1430-557-41-50 LTAC Approved TOTAL LODGING TAX FUND - 65,000 Sales Tax revenue collection 253,200 - 107-5160-337-10-10 Revenue Adjustment Overtime - 219,700 107-5160-528-10-11 FEMA grant - 10,800 107-5160-528-41-50 Grant FEMA grant - 34,900 107-5160-594-65-10 Grant FEMA grant 45,700 - 107-5160-333-97-00 Grant HipLink Software 27,000 - 107-5160-337-10-40 Jefferson shared cost HipLink Software - 27,000 107-5160-528-48-10 Approved by Council 07/18/23 TOTAL PENCOM FUND 325,900 292,400 Chamber of Commerce - 18,000 165-4078-558-41-50 TOTAL PBIA FUND - 18,000 Revenue Collection - Self Haul 257,300 - 404-7538-343-70-11 Revenue Adjustment Revenue Collection - Waste Connections 195,900 - 404-7538-343-70-13 Revenue Adjustment Revenue Collection - Residential Weekly 258,500 - 404-7580-343-70-16 Revenue Adjustment Revenue Collection - Commerical 97,600 - 404-7580-343-70-17 Revenue Adjustment Waste Connections Settlement - 497,500 404-7538-537-49-94 Transition of Solid Waste Services to City Operations Transfer Station; Contractual Services - 1,267,800 404-7538-537-41-51 Transition of Solid Waste Services to City Operations TOTAL SOLID WASTE FUND 809,300 1,765,300 PK0122 - Erickson Playfield Tennis Court Improvement 10,000 - 310-8985-397-10-91 Reprioritized in CFP GG1113 - Facility Security Projects 30,000 - 310-8985-397-10-91 Reprioritized in CFP PK0802 - Shane Park Tile Installation 85,700 - 310-8985-397-10-91 PK0802 - Shane Park Tile Installation - 85,700 310-8985-594-65-10 GG1113 - Facility Security Projects/City Hall Cameras - (288,600) 310-8985-594-65-10 Deferred to 2024 PK0122 - Erickson Playfield Tennis - (220,000) 310-8985-594-65-10 Deferred to 2024 PK0123 - Elks Pickleball Court Improvements - (30,000) 310-8985-594-65-10 Deferred to 2024 PK0205 - Restroom Replacement Program - (103,000) 310-8985-594-65-10 Deferred to 2024 PK0316 - Locomotive #4 Refurbishment - (50,000) 310-8985-594-65-10 Deferred to 2024 PK0719 - Parks Maintenance Building - (532,100) 310-8985-594-65-10 Deferred to 2024 TOTAL GOVERNMENT CAPITAL FUND 125,700 (1,138,000) TR0101 - Laurel Street Stairs - (48,900) 312-7930-595-65-10 Deferred to 2024 TR0115 - N St Chip Seal (5th to 18th Streets)- (550,000) 312-7930-595-65-10 Deferred to 2024 TR0121 - Pavement Management Plan - (200,000) 312-7930-595-65-10 Deferred to 2024 TR0222 - First/Front Pedestrian Enhancements - (170,000) 312-7930-595-65-10 Deferred to 2024 TR0321 - Speed Feedback Sign Program - (30,000) 312-7930-595-65-10 Deferred to 2024 TR0405 - Street and Alley Paving - (1,154,900) 312-7930-595-65-10 Deferred to 2024 TR0414 - Peabody Creek/Lincoln Street - (317,200) 312-7930-595-65-10 Deferred to 2024 TR0416 - Green Alleys 1st/2nd/Valley/Oak - (9,700) 312-7930-595-65-10 Deferred to 2024 TR0420 - 2023 Pavement Preservation - (400,000) 312-7930-595-65-10 Deferred to 2024 TR0619 - Race Street Complete Construction Phase II - (250,000) 312-7930-595-65-10 Deferred to 2024 TR0715 - 16th St LID (C-L)- (30,400) 312-7930-595-65-10 Deferred to 2024 TR0716 - ADA - Peabody Creek - (20,000) 312-7930-595-65-10 Deferred to 2024 TR0918 - Downtown Tree/Sidewalk Replacement Phase III - (495,000) 312-7930-595-65-10 Deferred to 2024 TR1118 - Revolving Street Improvements - (120,000) 312-7930-595-65-10 Deferred to 2024 TR1215 - City Hall East Parking lot - (1,115,500) 312-7930-595-65-10 Deferred to 2024 TR1799 - Truck Route and Hiway 101 Intersection - (84,200) 312-7930-595-65-10 Deferred to 2024 TOTAL TBD CAPITAL FUND - (4,995,800) BPA Incentives 300,000 - 421-7121-345-29-00 BPA Incentives - 300,000 421-7121-533-49-86 TOTAL CONSERVATION FUND 300,000 300,000 Detailed List of Proposed Budget Changes - 2023 Budget Amendment #3 December 5, 2023 G - 3 BUDGET AMENDMENT ITEM Revenues Expenditure Account Notes CL0919 - A St Substation Switchgear Replacement - 146,400 451-7188-594-65-10 Carried from 2022 CL0216 - City/PUD Agreement (Svc Area)- (175,000) 451-7188-594-65-10 Deferred to 2024 CL0217 - I Street Substation Switchgear Replacement - (345,000) 451-7188-594-65-10 Deferred to 2024 CL0414 - Light Ops Building - (1,300,000) 451-7188-594-65-10 Deferred to 2024 CL0420 - College St LTC Load Tap Changer Replacement - (175,000) 451-7188-594-65-10 Deferred to 2024 TOTAL ELECTRIC CAPITAL FUND - (1,848,600) Correct CFP Accounting Error(Add Water Projects)- (883,800) 452-7388-594-65-10 Accounting Error WT0121 - White Creek & 3rd St Crossing Main - (120,000) 452-7388-594-65-10 Deferred to 2024 WT0122 - Elwha - Fish Screen Facility Improvements - (349,000) 452-7388-594-65-10 Deferred to 2024 WT0123 - 11th Street ROW Tumwater Creek Crossing - (60,000) 452-7388-594-65-10 Deferred to 2024 WT0223 - 14th Street ROW Tumwater Creek Crossing - (60,000) 452-7388-594-65-10 Deferred to 2024 WT0218 - Reservoir Instrumentation Upgrades - (200,400) 452-7388-594-65-10 Deferred to 2024 WT0222 - Elwha - Effluent Distribution Structure Bypass - (152,000) 452-7388-594-65-10 Deferred to 2024 WT0320 - Morse Creek Transmission Main Eval/Design - (440,000) 452-7388-594-65-10 Deferred to 2024 WT0519 - Water Treatment Plant Repairs - (150,000) 452-7388-594-65-10 Deferred to 2024 WT0619 - Peabody Reservoir inlet pipe replac - (81,400) 452-7388-594-65-10 Deferred to 2024 TOTAL WATER CAPITAL FUND - (2,496,600) Correct CFP Accounting Error (Remove Water Projects)- 883,800 453-7488-594-65-10 Accounting Error WW0122 - Anaerobic Digester Roof Improvements - (250,900) 453-7488-594-65-10 Deferred to 2024 WW0220 - West 4th St Capacity Improvement - (1,202,700) 453-7488-594-65-10 Deferred to 2024 WW0419 - WWTP HVAC Replacement - (40,900) 453-7488-594-65-10 Deferred to 2024 WW0320 - WWTP Septic Truck Pad Repair - (22,000) 453-7488-594-65-10 Deferred to 2024 TOTAL WASTEWATER CAPITAL FUND - (632,700) SW0122 - Landfill Automated Facility Gate - (110,000) 454-7588-594-65-10 Deferred to 2024 TOTAL SOLID WASTE CAPITAL FUND - (110,000) DR0213 - H Street Outfall Improvements - (102,000) 456-7688-594-65-10 Deferred to 2024 DR0215 - Francis Street Outfall - (40,000) 456-7688-594-65-10 Deferred to 2024 DR0322 - Park Ave. Outfall to Peabody Creek - (198,000) 456-7688-594-65-10 Deferred to 2024 DR0804 - Lincoln Park Big Boy Pond Study - (40,000) 456-7688-594-65-10 Deferred to 2024 TOTAL STORMWATER CAPITAL FUND - (380,000) WW0316 - CSO 6 & 7 - (15,000) 463-7489-594-65-10 Deferred to 2024 TOTAL CSO CAPITAL FUND - (15,000) #194 GMC Sonoma Pick-up (Finance)- (39,900) 501-7630-594-64-10 Deferred to 2024 #1310- Ford Crown Victoria (Police)- (53,500) 501-7630-594-64-10 Deferred to 2024 #1311- Chevrolet Caprice (Police)- (53,500) 501-7630-594-64-10 Deferred to 2024 #6101- Chevrolet Colorado 4X4 Volunteer (Police)- (53,600) 501-7630-594-64-10 Deferred to 2024 #3 Pierce Pumper (Fire)- (985,000) 501-7630-594-64-10 Deferred to 2024 #2020 2001 Ford Explorer (Fire)- (47,200) 501-7630-594-64-10 Deferred to 2024 #4328 GMC Sierra 3500 Flat Bed (Parks)- (100,600) 501-7630-594-64-10 Deferred to 2024 #1887 Ford F450 Flatbed/Snow Plow (Parks)- (82,300) 501-7630-594-64-10 Deferred to 2024 Streets Truck Sander - 52,500 501-7630-594-64-10 Carried from 2022 #4900 GMC Savanna Van (Light Ops)- (50,400) 501-7630-594-64-10 Deferred to 2024 #133 Chevy Blazer (Light Ops)- (40,700) 501-7630-594-64-10 Deferred to 2024 #135 Chevy Blazer (Light Ops)- (40,700) 501-7630-594-64-10 Deferred to 2024 #1950 Freightliner/Versalift Manift (Light Ops)- (275,600) 501-7630-594-64-10 Deferred to 2024 #148 Catepillar Forklift (Light Ops)- (31,500) 501-7630-594-64-10 Deferred to 2024 #6702 GMC Canyon Pickup (Water)- (39,500) 501-7630-594-64-10 Deferred to 2024 #1756 John Deere Backhoe Loader (Water)- (131,400) 501-7630-594-64-10 Deferred to 2024 #1616 Ford F350 Service Truck (Wastewater)- (68,300) 501-7630-594-64-10 Deferred to 2024 #4600 GMC Sierra 1500 4X4 Pick-up (Wastewater)- (58,200) 501-7630-594-64-10 Deferred to 2024 #1945 Ford Ranger Pick-up (Solid Waste)- 68,500 501-7630-594-64-10 Increased Cost #2184 Ecostack 503W Conveyor (Solid Waste)- (32,100) 501-7630-594-64-10 Deferred to 2024 #1240 Freightliner Air Sweeper (Stormwater)- (375,000) 501-7630-594-64-10 Deferred to 2024 Herb Spray Attachment (Stormwater)- (9,500) 501-7630-594-64-10 Deferred to 2024 #1569 Catepillar WHL Loader (Equipment Services) - (30,000) 501-7630-594-64-10 Deferred to 2024 TOTAL EQUIPMENT SERVICES FUND - (2,477,500) Annual Lease Subscription Reconciliation - 315,000 502-2081-518-48-02 Approved by Council 11/21/23 IT0623 - IT Pure Storage Upgrade - 174,000 502-2082-594-65-10 Approved by Council 10/17/23 IT0716 - ERP Road Map - (2,000,000) 502-2082-594-65-10 Deferred to 2024 TOTAL IT FUND - (1,511,000) AWC Insurance Premiums - 370,000 503-1631-517-46-30 AWC Insurance Premiums 370,000 - 503-1631-365-90-20 NW Admin Teamsters Premiums - 67,000 503-1631-517-46-33 NW Admin Teamsters Premiums 67,000 - 503-1631-365-90-23 Liability Insurance Premium - 435,600 503-1671-517-46-10 TOTAL SELF-INSURANCE FUND 437,000 872,600 December 5, 2023 G - 4 ORDINANCE NO._____ AN ORDINANCE of the City of Port Angeles, Washington, amending the City’s 2023 budget for the third time. WHEREAS, the Annual Budget of the City of Port Angeles for the year 2023, was adopted, approved and confirmed on December 6, 2022, in Ordinance No. 3705; and WHEREAS on April 18, 2023, the first 2023 budget amendment was adopted, approved and confirmed by Ordinance No. 3712; and WHEREAS on August 15, 2023, the second 2023 budget amendment was adopted, approved and confirmed by Ordinance No. 3717; and WHEREAS, now there exists an emergency that could not reasonably have been foreseen when the 2023 budget or the first amendment to it were adopted. NOW, THEREFORE, the City Council of the City of Port Angeles, Washington, do ordain as follows: Section 1. The Council finds and declares: A. There exists an emergency that could not reasonably have been foreseen when the 2023 budget or the first amendment to it were adopted. The facts constituting the emergency include, but are not limited to: 1. Unanticipated additional revenue; and 2. Unanticipated reduced revenue; and. 3. Unanticipated additional and reduced expenditures primarily for changes in planned capital expenditures as previously authorized by Council. B. These facts require amendments to the adopted budget in order to meet the expenses of government of the City for the fiscal year ending December 31, 2023. December 5, 2023 G - 5 Section 2. On the basis of the foregoing findings, pursuant to RCW 35A.33.090, the City Council declares that an emergency exists. Section 3. To respond to the budget emergency, the 2023 budget appropriation for each separate fund as set forth in Ordinance No.3705, is amended as shown in the attached Exhibit A. Section 4. The City Clerk and the codifiers of this ordinance are authorized to correct scrivener’s errors, references, ordinance numbering, section and subsection numbers and any references thereto. Section 5. This Ordinance exercises authority granted exclusively to the City Council and is not subject to referendum. It shall be in force and take effect 5 (five) days after publication according to law. PASSED by the City Council of the City of Port Angeles by a vote of one more than the majority of all members of the legislative body at a regular meeting of said Council on the _____ day of ______________, 2023. _______________________________ Kate Dexter, Mayor ATTEST: APPROVED AS TO FORM: _______________________________ _______________________________ Kari Martinez-Bailey, City Clerk William E. Bloor, City Attorney PUBLISHED: ___________________ By Summary December 5, 2023 G - 6 CITY of PORT ANGELES 2023 Budget Ordinance - Amendment #3 Exhibit A Fund Div.Name / Description Beginning Revenue Expenditures Ending Beginning Revenue Expenditures Ending Balance Balance - Est. Balance Balance - Est. GENERAL FUND (Note: Divisional totals for reference only) Fund Balance:6,703,665 5,340,565 6,703,665 6,059,665 001.1160 City Council 40,700 71,800 40,700 71,800 001.1210 City Manager 343,300 674,800 343,300 674,800 001.1211 Customer Commitment - 2,500 - 2,500 001.1220 Human Resources 104,300 304,300 104,300 304,300 001.1230 City Clerk 131,500 294,800 131,500 294,800 001.2001 Finance - Revenue 15,180,800 - 15,969,200 - 001.2020 Finance Administration 155,100 971,400 155,100 971,400 001.2023 Accounting 802,000 1,101,000 802,000 1,101,000 001.2025 Customer Service 1,329,100 1,283,200 1,329,100 1,283,200 001.2070 Reprographics 37,900 46,600 37,900 46,600 001.3030 City Attorney 217,200 595,300 217,200 595,300 001.3012 Jail Contributions - 1,041,100 - 1,041,100 001.4060 Planning 430,800 792,600 430,800 792,600 001.4050 Building 674,200 268,500 674,200 268,500 001.4071 Economic Development 50,000.00 121,900 50,000.00 121,900 001.5010 Police Administration 1,000 653,600 101,000 653,600 001.5012 PenCom/Capital Transfers 370,100 703,800 370,100 703,800 001.5021 Police Investigation 2,700 1,196,300 2,700 1,196,300 001.5022 Police Patrol 837,100 4,311,000 853,800 4,414,000 001.5026 Police Reserves & Volunteers - 10,100 - 10,100 001.5029 Police Records 12,200 484,400 12,200 484,400 001.5050 Police Facilities Maintenance 16,300 8,600 16,300 8,600 001.6010 Fire Administration 64,200 246,300 64,200 246,300 001.6012 PenCom/Medic I Support - 378,900 - 378,900 001.6020 Fire Suppression - 1,546,600 11,700.00 1,550,600 001.6030 Fire Prevention 9,600 115,500 9,600 115,500 001.6045 Fire Training 3,000 119,600 3,000 119,600 001.6050 Fire Facilities Maintenance - 61,100 - 66,100 001.7010 Public Works Administration 1,241,400 2,545,100 1,241,400 2,545,100 001.7012 Public Works CIP - 161,000 - 161,000 001.7032 Public Works Telecommunications 32,800 32,800 32,800 32,800 001.8010 Parks Administration - 295,900 - 295,900 001.8012 Senior Center 29,500 168,500 29,500 168,500 001.8050 Ocean View Cemetery 135,000 194,800 135,000 194,800 001.8080 Park Facilities - 2,440,300 - 2,526,000 001.8112 Senior Center Facilities - 60,400 - 60,400 001.8131 Central Services Facilities 470,200 496,600 470,200 496,600 001.8155 Facility Rentals 72,000 125,300 72,000 125,300 001.8221 Sports Programs - 132,300 - 132,300 001.9029 General Unspecified 395,500 494,000 1,072,300 1,170,800 001 TOTAL General Fund 6,723,372 23,189,500 24,552,600 5,340,565 6,723,372 24,783,100 25,427,100 6,059,665 Funds 2023 Budget Amendment #32023 Budget Amendment #2 December 5, 2023 G - 7 CITY of PORT ANGELES 2023 Budget Ordinance - Amendment #3 Exhibit A SPECIAL REVENUE FUNDS 101 Lodging Excise Tax Fund 1,307,750 764,100 897,100 1,174,750 1,307,750 764,100 962,100 1,109,750 102 Street Fund 566,386 1,928,600 2,101,500 393,486 566,386 1,928,600 2,101,500 393,486 105 Real Estate Excise Tax-1 (REET-1) Fund 1,082,076 321,800 900,600 503,276 1,082,076 321,800 900,600 503,276 107 PenCom Fund 2,070,242 3,744,200 4,367,200 1,447,242 2,070,242 4,070,100 4,659,600 1,480,742 160 Real Estate Excise Tax-2 (REET-2) Fund 773,723 320,100 1,076,300 17,523 773,723 320,100 1,076,300 17,523 165 Business Improvement Area 64,671 35,000 - 99,671 64,671 35,000 18,000 81,671 172 Port Angeles Housing Rehab. Fund 1,842,620 1,155,700 662,600 2,335,720 1,842,620 1,155,700 662,600 2,335,720 175 Code Compliance Fund 56,285 261,900 261,900 56,285 56,285 261,900 261,900 56,285 TOTAL Special Revenue Funds 7,763,751 8,531,400 10,267,200 6,027,951 7,763,751 8,857,300 10,642,600 5,978,451 Fund Div.Name / Description Beginning Revenue Expenditures Ending Beginning Revenue Expenditures Ending Balance Balance - Est.Balance Balance - Est. DEBT SERVICE FUNDS 216 2014 LTGO Bond (Landfill Bluff Stabilization) Fund 156,692 604,300 600,800 160,192 156,692 604,300 600,800 160,192 217 2015 LTGO Bond - Refunding (W.U.G.A.)14,775 232,900 232,200 15,475 14,775 232,900 232,200 15,475 TOTAL Debt Service Funds 171,467 837,200 833,000 175,667 171,467 837,200 833,000 175,667 ENTERPRISE / UTILITY FUNDS 401 Electric Utility Fund 11,855,385 28,876,200 27,578,500 13,153,085 11,855,385 28,876,200 27,578,500 13,153,085 402 Water Utility Fund 13,606,411 7,447,300 9,408,500 11,645,211 13,606,411 7,447,300 9,408,500 11,645,211 403 Wastewater Utility Fund 3,109,707 7,685,900 8,421,200 2,374,407 3,109,707 7,685,900 8,421,200 2,374,407 404 Solid Waste Utility Fund 203,465 12,449,600 12,880,700 (227,635)203,465 13,258,900 14,646,000 (1,183,635) 406 Stormwater Utility Fund 2,013,649 2,768,400 3,212,700 1,569,349 2,013,649 2,768,400 3,212,700 1,569,349 409 Medic 1 Utility Fund 1,209,657 3,810,500 3,856,200 1,163,957 1,209,657 3,810,500 3,856,200 1,163,957 413 Harbor Clean-up Fund (381,971)2,050,600 2,050,600 (381,971)(381,971)2,050,600 2,050,600 (381,971) 421 Conservation Fund 273,286 348,000 347,500 273,786 273,286 648,000 647,500 273,786 TOTAL Enterprise / Utility Funds 31,889,589 65,436,500 67,755,900 29,570,189 31,889,589 66,545,800 69,821,200 28,614,189 INTERNAL SERVICE FUNDS 501 Equipment Services 4,958,858 2,413,600 4,942,700 2,429,758 4,958,858 2,413,600 2,465,200 4,907,258 502 Information Technology 2,879,365 2,336,700 4,816,800 399,265 2,879,365 2,336,700 3,305,800 1,910,265 503 Self-Insurance 708,766 6,346,500 6,346,500 708,766 708,766 6,783,500 7,219,100 273,166 TOTAL Internal Service Funds 8,546,989 11,096,800 16,106,000 3,537,789 8,546,989 11,533,800 12,990,100 7,090,689 FIDUCIARY FUNDS 602 Firemen's Pension Fund 212,811 19,200 69,400 162,611 212,811 19,200 69,400 162,611 TOTAL Fiduciary Funds 212,811 19,200 69,400 162,611 212,811 19,200 69,400 162,611 PERMANENT FUNDS 601 Cemetery Endowment Fund 397,696 3,400 - 401,096 397,696 3,400 - 401,096 TOTAL Permanent Funds 397,696 3,400 - 401,096 397,696 3,400 - 401,096 CAPITAL FUNDS 310 Governmental Capital Improvement Fund 2,943,726 6,070,200 7,688,100 1,325,826 2,943,726 6,195,900 6,550,100 2,589,526 312 Transportation Capital 4,866,614 10,620,800 12,913,500 2,573,914 4,866,614 10,620,800 7,917,700 7,569,714 316 Governmental Park Improvement Fund 307,906 9,600 - 317,506 307,906 9,600 - 317,506 451 Electric Capital Fund 13,022,083 800,000 2,940,000 10,882,083 13,022,083 800,000 1,091,400 12,730,683 452 Water Capital Fund 5,346,683 765,000 4,132,000 1,979,683 5,346,683 765,000 1,635,400 4,476,283 453 Wastewater Capital Fund 4,376,875 978,500 3,461,800 1,893,575 4,376,875 978,500 2,829,100 2,526,275 454 Solid Waste Capital Fund 1,262,431 1,677,600 1,424,200 1,515,831 1,262,431 1,677,600 1,314,200 1,625,831 456 Stormwater Capital Fund 3,089,060 443,000 480,000 3,052,060 3,089,060 443,000 100,000 3,432,060 463 Combined Sewer Overflow Capital Fund 3,117,330 4,857,300 7,245,400 729,230 3,117,330 4,857,300 7,230,400 744,230 TOTAL Capital Funds 38,332,707 26,222,000 40,285,000 24,269,707 38,332,707 26,347,700 28,668,300 36,012,107 SUB-TOTAL ALL FUNDS 94,038,383 135,336,000 159,869,100 69,485,576 94,038,383 138,927,500 148,451,700 84,494,476 Reserves - Designated 2,135,100 5,273,200 Reserves Used 26,668,200 14,797,400 TOTAL CITYWIDE ALL FUNDS 94,038,383 162,004,200 162,004,200 69,485,576 94,038,383 153,724,900 153,724,900 84,494,476 Funds 2023 Budget Amendment #32023 Budget Amendment #2 December 5, 2023 G - 8 Date: December 5, 2023 To: City Council From: Nathan A. West, City Manager Corey Delikat, Parks & Recreation Director Subject: HVAC Upgrades - Port Angeles Senior Center (PK-0320) Background / Analysis: During the August 16, 2022 City Council meeting, during an ARPA funding update, staff recommended the use of ARPA funding for upgrading the HVAC systems at City Hall/Vern Burton, the Senior Center and the Fire Hall. Staff was directed by Council to bring back additional information about these projects at a later date. On November 1, 2022, the City invited TRANE Technologies to discuss more in depth about these Capital Facility Plan projects. Items that TRANE discussed and highlighted were: Procurement options such as the Washington State Department of Enterprise Service using the Energy Savings Performance Contracting program. Deficiencies in the HVAC systems at the Senior Center, Fire Hall and Vern Burton/City Hall. Renewable energy options such as solar panels and battery storage that align with the City’s Climate Resiliency Plan. Grant and funding opportunities; and Updated cost estimates for the upgrade of each system. This presentation led Council to approve a contract during the December 20, 2022 City Council Meeting to allow TRANE Technologies to provide the City a 30% design through an Investment Grade Audit (IGA) resulting in the ability to receive bids for a Guaranteed Maximum Price (GMAX) for the projects. On September 19, 2023, TRANE Technologies updated the Council by giving them a presentation of the status of Capital Facilities Plan Project PK0320 which included: Summary: In December of 2022, the City entered into an agreement with TRANE Technologies, Inc. through the Washington State Department of Enterprise Services program to design, build and replace the City’s outdated HVAC systems in the City Hall complex, Senior Center, and Fire Station. A request to utilize American Rescue Plan Act (ARPA) funds for the upgrade of these systems has been made previously for Council’s consideration. Funding: Utilize ARPA Funding to complete the HVAC upgrades to the Port Angeles Senior Center, including solar and battery storage, in the amount of $1,792,110.00, which includes sales tax and grant incentives. This is recommended to be funded from ARPA funds not yet obligated to other purposes. Recommendation: 1.) Approve a Resolution to authorize the City Manager to use ARPA funding to replace the HVAC systems for the Port Angeles Senior Center in the amount of $1,792,110.00 and; 2.) allow the City Manager to sign any contracts/documents with TRANE Technologies Inc. and Washington State Department of Enterprise Services (DES) and; 3.) allow the City Manager to make any minor modifications to the agreements if necessary. December 5, 2023 H - 1 Building renewal Opportunities Progress Update Alternative Energy Opportunities & Grants Staff is recommending Council approve a resolution authorizing the City Manager to utilize ARPA funds that are not yet obligated in the amount of $1,792,110.00 to move forward with the replacement of the HVAC System at the Port Angeles Senior Center, which will include solar panels and battery storage enhancements. The remaining ARPA funds available for use are $1,990,400.00. Unfortunately, the estimates for similar work at City Hall/Vern Burton and the Fire Hall are far in excess of available funds. The total costs of the project is $1,792,110.00 and below is an outline of the proposed funding for the project: City of Port Angeles Energy Upgrades Cost Ph 1 Senior Center HVAC $1,588,088 Ph 2 Senior Center Solar + Storage $1,044,022 State Solar Grant ‐$500,000.00 Estimated Federal Investment Tax Credit ‐$350,000.00 Total $1,792,110.00 Additionally, the estimated federal investment tax credit would be initially paid by the City and received as a future tax credit. City Staff is recommending the use of existing funds held for general capital projects to initial fund the project until the credit is received. Funding Overview: Utilize ARPA Funding to complete the HVAC upgrades to the Port Angeles Senior Center, including solar and battery storage, in the amount of $1,792,110.00, which includes sales tax and grant incentives. This is recommended to be funded from ARPA funds not yet obligated to other purposes. December 5, 2023 H - 2 1 RESOLUTION NO. A RESOLUTION of the City Council of the City of P ort Angeles, Washington, approving funding from the American Rescue Plan Act (ARPA) for Senior Center HVAC system that will include solar power and battery back-up. WHEREAS, the Office of Financial Management (OFM) notified the City that it will be receiving $5,646,884 from in American Rescue Plan Act (ARPA) funding; and WHEREAS, Staff compiled eligible ARPA funding options and presented recommendations in a July 6th, 2021 Memorandum to Council; and WHEREAS, during the July 6, 2021, July 20, 2021 and August 17, 2021 City Council meetings a discussion was held on the utilization of ARPA funding; and WHEREAS, during the September 7, 2021 and October 19, 2021 City Council meetings, Council discussed in detail several other items recommended by Staff for this funding; and WHEREAS, during the August 16, 2022 City Council meeting, during an ARPA funding update, staff recommended the use of ARPA funding to look at upgrading the HVAC systems at the Port Angeles Senior Center, City Hall, and the Fire Hall. WHEREAS, on November 1, 2022, the City invited TRANE Technologies to talk more in depth about these Capital Facility Plan projects. This presentation lead Council to approve a contract during the December 20, 2022 City Council Meeting to allow TRANE to provide to the City a 30% design through an investment Grade Audit (IGA) resulting in the ability to receive bids for a Guaranteed Maximum Price (GMAX) for potential projects; WHEREAS, On September 19, 2023, TRANE updated the Council by giving another presentation of Capital Facilities Plan Project PK-0320 which included building renewal opportunities, progress updates, and alternative energy opportunities and grants; NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Port Angeles, Washington: December 5, 2023 H - 3 2 THAT the City Manager is hereby authorized to use ARPA funding to replace the HVAC system for the Port Angeles Senior Center in the amount of $1,792,110.00 and allow the City Manager to sign any contracts/documents with TRANE Technologies Inc. and Washington State Department of Enterprise Services; AND, THAT the City Manager is authorized to negotiate such details, conditions, contract amendments, subrecipient agreements, and other terms as appropriate to carry out the funding authorized above. PASSED by the City Council of the City of Port Angeles at a regular meeting of said Council held on the 5th day of December, 2023. _______________________________ Kate Dexter, Mayor ATTEST: _______________________________ Kari Martinez-Bailey, City Clerk APPROVED AS TO FORM: _______________________________ William E. Bloor, City Attorney December 5, 2023 H - 4 Energy Savings Proposal Prepared by: Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 November 9, 2023 City of Port Angeles Senior Center Energy Upgrades Phase 1: HVAC 328 E 7th St Port Angeles, WA 98362 DES Audit Agreement # 23-227 c/o Department of Enterprise Services 1500 Jefferson Street SE PO Box 41012 Olympia, WA 98504-1012 Website: www.des.wa.gov December 5, 2023 H - 5 1 CONTACTS Site Contact The following facility personnel assisted with this report: Corey Delikat Director of Parks & Recreation City of Port Angeles 308 East 4th Street Port Angeles, WA 98362 Direct: (360) 417-4551 Email: Cdelikat@cityofpa.us Department of Enterprise Services Contact The DES Project Manager (PM) is: Novella Randall Project Manager Washington State Department of Enterprise Services 1500 Jefferson Street Southeast Olympia, Washington 98501 Phone: 360-790-3667 E-mail: novella.randall@des.wa.gov Utility Contact Gregg King Power Resources Manager 321 E 5th St Port Angeles, WA 98362 Phone: 360-417-4710 E-mail: gking@cityofpa.us ESCO Contact Information The Energy Savings Company (ESCO) that prepared this report are: Greg Stinson Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 Phone: (425) 256-1717 E-mail: Greg.Stinson@tranetechnologies.com December 5, 2023 H - 6 2 Table of Contents 1 Executive Summary ............................................................................................................. 3 Project Overview .......................................................................................................... 3 Selected Energy Conservation Measures Summary .................................................... 4 1.2.1 ECMs Considered but Deferred ............................................................................ 4 Project Costs and Benefits ........................................................................................... 4 Conclusion ................................................................................................................... 4 2 Financial Analysis ................................................................................................................ 5 Maximum Project Allowable Costs ............................................................................... 5 Items Included in Maximum Project Cost ..................................................................... 5 Project Contingency ..................................................................................................... 6 Allowances .................................................................................................................. 7 Measurement & Verification (M&V) .............................................................................. 7 Reconciliation of Construction Costs ............................................................................ 7 Energy Services Company (ESCO) Compensation ...................................................... 7 Payment Terms ...................................................................................................................... 7 Finance Charges on Unpaid Balance ..................................................................................... 8 Substantial and Final Completion ........................................................................................... 8 Terms of Agreement .................................................................................................... 8 3 Scope of Work ................................................................................................................... 10 Energy Conservation Measures Narrative ...................................................................10 ESCO Services ...........................................................................................................10 Project Schedule .........................................................................................................12 Detailed Scope of Work ..............................................................................................12 4 Energy and Performance Guarantee .................................................................................. 17 Savings and Project Incentives ...................................................................................17 4.1.1 Annual Utility Cost Savings ..................................................................................17 4.1.2 Annual Maintenance/Operations Costs Impact ....................................................17 Detailed Energy Calculations ......................................................................................17 Utility Data ..................................................................................................................17 Energy and Performance Guarantee ..........................................................................18 Measurement and Verification (M&V) Plan .................................................................20 December 5, 2023 H - 7 3 1 Executive Summary Project Overview Trane is pleased to provide the following Energy Services Proposal (ESP) for HVAC and controls improvements at the City of Port Angeles’s Senior Center. The scope and costs herein reflect Trane’s work to date and are proposed as the guaranteed maximum (GMAX) project cost and guaranteed minimum savings per the State’s Energy Savings Performance Contracting (ESPC) program. The City of Port Angeles selected Trane US Inc. to complete an Investment Grade Audit (IGA) of the Facility through the State’s ESPC program, administered by the State of Washington’s Department of Enterprise Services (DES). This phase of the IGA focused on improvements to the Facility HVAC systems. The proposed measures will reduce energy use and utility costs. The key objectives the Owner identified for this project are: Reduce energy costs by using more efficient equipment and improving processes Upgrade equipment to meet state code specifications Avoid capital costs the City of Port Angeles will incur should existing equipment remain in service, fail, and require emergency replacement Maximize system life and reliability Specified equipment maximizes operational efficiencies and requires less routine maintenance Maximize energy conservation incentives from City Power Trane completed the Investment Grade Audit (IGA) of the building. Through this IGA, Trane has presented the City of Port Angeles with a project solution that improves system operation, addresses capital improvement needs, meets the Cost Effectiveness Criteria and maximizes energy efficiency. This project includes upgrades and renovations to various systems within the building as outlined in Section 1.2. December 5, 2023 H - 8 4 Selected Energy Conservation Measures Summary ECM-1 Senior Center HVAC Renewal The intent of this measure is to replace the existing system with new heat pumps and air handling systems. Trane used a load analysis to determine the sizes of new air handlers that are required. Given the limited access to the attic, Trane designed a system that relies on modular air handler units that will be connected together with duct work. The system will use the existing relief air duct as a mixing plenum where outdoor air will be added from an energy recovery ventilator. The measure will add a makeup air unit to provide 100% outdoor air to the kitchen. The measure would remove the existing DDC control system and install a new DDC system connected with hardwiring or Wi-Fi. 1.2.1 ECMs Considered but Deferred There were measures investigated during the IGA but are not a part of this ESP, details about these measures can be found in section 3 of IGA report dated November 6, 2023. Project Costs and Benefits Trane guarantees that the Maximum Project Cost will not exceed $1,410,241. Sales tax, the Department of Enterprise Service’s fees and utility incentives are not guaranteed nor are they incorporated in the Maximum Project Cost. Total project cost inclusive of sales tax and Department of Enterprise Service’s fee is $1,588,088. Refer to Section 2 of this ESP for further details. Price is valid for 30 days. This project will generate the following benefits for the City of Port Angeles: Achieve guaranteed annual energy savings totaling 47,307 kWh Achieve annual utility cost avoidance totaling $2,838 per year Potentially qualify for energy conservation incentives from City’s Utility Replace failed and failing equipment; no maintenance or operational cost reductions have been quantified Improve system and equipment reliability Conclusion Trane appreciates the opportunity to present this ESP. The measures described in this proposal demonstrate that the City of Port Angeles is actively working to optimize operations and minimize energy and operational costs. Trane looks forward to working with City of Port Angeles Staff and the Department of Enterprise Services on the implementation of this project. December 5, 2023 H - 9 5 2 Financial Analysis The investment grade audit (IGA) was used to develop the costs for the proposed ECMs. Table 2.1, Budget Summary, presents open book financials of the project. Maximum Project Allowable Costs Trane guarantees that the Maximum Project Cost will not exceed $1,410,241. Sales tax, the Department of Enterprise Service’s fees and utility incentives are not guaranteed nor are they incorporated in the Maximum Project Cost. Total project cost inclusive of sales tax and Department of Enterprise Service’s fee is $1,588,088. Refer to Table 2.1 in this section of the ESP for further details. Items Included in Maximum Project Cost Maximum Project Cost includes the following: 1. Investment Grade Audit 2. Engineering a. 10% of labor and materials (not including Project Site Resources) for design service 3. Construction Management Services a. 6% of labor and materials for construction management/administration b. All activities and services required to manage Trane’s labor force or its Subcontractors for the purchase and installation of the equipment as applicable in the Construction Contract. These include but are not limited to contract administration, preparation of meeting minutes, schedule creation, issuance of request for proposals (RFP), submittal processing, purchasing, invoicing, development and delivery of as-built drawings and creation and delivery of project closeout documents. This is not supervision as provided by the Site Superintendent. 4. Measurement and Verification Fee (One year only) 5. Project Contingency 6. Installation cost includes: a. All costs paid by Trane for the installation of the Project equipment. This includes costs paid to subcontractors or directly to Trane personnel, when related to installation or system verification of Project equipment. b. Site Supervision includes, but is not limited to, all activities executed by an employee of the ESCO in the active supervision of its own labor force and its subcontractors, coordination of craft laborers’ work, schedules, as-needed daily work progress reports, quality controls, site security, creation and enforcement of the site-specific safety plan, coordination with site tenants and other tasks that can only be effectively performed onsite. Site Supervision activities do not include Construction Management. Examples of substantiated hours include: i. when the project superintendent/site supervisor is on site and doing the previously mentioned site supervision activities. ii. when the project manager is on site or coordinating on site work while off site iii. when the safety manager is conducting safety audits, developing the safety plan, or providing supervision on site December 5, 2023 H - 10 6 c. The portion of reasonable travel, lodging and meals expenses of Trane or of its officers or employees incurred while traveling in discharge of duties connected with the Work in accordance with Section C of the Main Energy Services Agreement (MESA). (Applicable only on projects more than 50 miles from Trane’s office). d. Cost of all equipment, materials, supplies, and equipment incorporated in the Work, including costs of transportation thereof in accordance with the MESA. e. Cost of premiums for all bonds and insurance, which Trane is required to purchase and maintain. f. Permit fees, royalties and deposits lost for causes other than Trane’s negligence. g. Sales, use, or similar taxes related to the Work and for which Trane is required to purchase and maintain. h. Losses and expenses not compensated by insurance or otherwise, sustained by Trane in connection with the work, provided they have resulted from causes other than the fault or neglect of Trane or its subcontractors. Such losses shall include settlements made with the written consent and approval of the Owner and the DES project manager. If, however, such loss requires reconstruction and Trane is placed in charge thereof, Trane shall be compensated for such services. i. Reimbursable expenses as contemplated in Section III C of the MESA. j. Demolition cost and cost of removal of all debris unless specifically excluded in the Scope of Work. k. Other costs incurred in the performance of the Work if and to the extent approved in advance in writing by the Owner. l. Contingency and Allowances as defined in Sections 2.3 and 2.4 of this ESP m. Cost of equipment startup, training, system verification, commissioning and balancing performed by Trane. n. Metering equipment costs for any permanent metering or monitoring equipment left on site. o. Trane shall provide a Schedule of Values prior to first payment application. The schedule of values will include all costs related to the installation of equipment, with the exclusion of fixed fee items. Fixed fee items include the IGA fee, Design, Construction Management, Overhead and Profit listed in Table 2.1 of this ESP. 7. Construction Bonds, Liability Insurance and Builder’s Risk Insurance. a. 1.5% of construction costs as defined in the ESP for bonding 8. For projects over $1 million, the apprenticeship incentive is added 9. Trane fee. This includes Trane’s remuneration overhead and profit. This is a fixed fee. a. 18% of labor and materials for overhead and profit Project Contingency A project contingency as identified in Table 2.1, Project Cost, has been established for this project. Trane can expend the amount of contingency listed in the executed change order after a change order has been approved by the Owner and DES for items necessary to complete the original scope of this project. The intent of the contingency is for “unforeseen conditions” beyond what was originally estimated. Any construction period financing costs shall also be paid from this fund. Trane shall be allowed to mark-up contingency funds expended for this project in accordance with the General Conditions of the MESA and at rates defined in Table 2.1. Trane, the DES and December 5, 2023 H - 11 7 the Owner will jointly manage any contingency left after the project scope is completed. All unused project contingency funds shall reduce the overall project cost to the Owner. Allowances As agreed by the Owner and DES, Trane may set aside allowances that will be identified in Table 2.1, Project Cost, for specific areas of work that are a potential cost impact but cannot be determined during the IGA. Should the agreed upon allowance not be adequate, the Owner and DES will be advised and Trane may be compensated for any additional costs via Change Order to the Contract subject to adequate substantiation and agreement by the Owner and DES. If actual costs for scope identified as allowance are less than the allowance amount in Table 2.1, the difference will be allocated to Contingency. In extreme situations, Trane may request additional funds via change order to cover cost overruns that could not have been foreseen by either party. Any change orders are subject to approval by the Owner and DES. No allowance value has been identified for this project. Measurement & Verification (M&V) One (1) year of Measurement and Verification (M&V) is included for this project as defined in Section 4.5 of this ESP and consistent with the MESA. No other on-going services have been proposed. Reconciliation of Construction Costs The guaranteed maximum project cost is based on firm negotiated bids or estimated Labor & Material costs developed by Trane. In recognition that actual construction costs may vary from the estimate, the following procedures are established to reconcile this difference: 1. If actual total Labor & Material costs exceed the estimated Labor & Material costs (plus Contingency), the additional expense will be borne by Trane without affecting the Owner’s payment. 2. If actual total Labor & Material costs are less than the estimated Labor & Material costs (plus Contingency), the remaining funds will be retained by the Owner. Energy Services Company (ESCO) Compensation Payment Terms Owner shall pay Trane or cause Trane to be paid for the Services as follows and in accordance with the MESA (this may be modified by funding source requirements and client reimbursement schedules): 1. Initial Payment - Upon receipt of notice to proceed and an executed contract, Trane will invoice for the following: a. Investment Grade Audit fee b. Other fees as appropriate including a portion of design, construction management and bonding 2. Monthly Progress Billing will commence after filing intent and if necessary, an apprenticeship plan, December 5, 2023 H - 12 8 a. All materials and equipment delivered to the Premises and stored in a secure and insured location (or, as applicable, to an off-site storage facility as detailed in DES General Conditions Section 6.05, item D) b. All installation, labor and ESCO Fees performed, less project retention (if applicable) c. As approved by Owner and DES 3. Final Payment - Project Retention (if applicable) DES will review all invoices, and forward them to the Owner. Owner shall pay all amounts due upon receipt of the invoice unless the Owner has concerns or needs additional information about the invoice. The Owner may request this information within (8) days in accordance with RCW 39.76. Any invoice not paid within thirty (30) calendar days after submittal of all requested material shall be past due. Finance Charges on Unpaid Balance All amounts outstanding thirty (30) calendar days after the Owner receives all requested information shall bear interest payable to Trane at a rate of 1 percent per month per RCW 39.76.011. Substantial and Final Completion Unless a retention bond is used, retention will be released within (45) days after receipt of all lien releases, L&I, Revenue and Employment Security certificates and releases by the Owner. When Trane considers that the Services, or a portion thereof, are substantially complete, Trane will submit to the Owner and DES a proposed “punch list” listing items of the Services to be completed prior to final completion. Owner, DES and Trane shall inspect the Services (or portion thereof) to determine if the same is substantially complete. Substantial Completion is defined in the General Conditions of the MESA. Terms of Agreement The contract shall be effective and binding upon its execution and the period from contract execution until the Commencement Date shall be known as the “Interim Period.” All energy savings achieved during the interim period will be fully credited to Owner. The total project cost is valid if a construction contract has been issued to Trane on or before 10/19/2023. If the contracts are received after this date, Trane reserves the right to review and update total project costs based on updated project initiation date. December 5, 2023 H - 13 TABLE 2.1 - PROJECT COST City of Port Angeles Ph 1 Senior Center HVAC Renewal A. CONSTRUCTION COSTS Costs ECM-1 Senior Center (4) HP + AHUs + MAU + ERVs + Controls 789,717$ Reimbursable Expenses (Lodging, Per Diem, etc.)16,426$ Safety, Site Conditions 15,163$ Project Site Resources 152,112$ Subtotal Labor and Materials Cost 973,418$ Construction Bond 1.50%14,601$ TOTAL CONSTRUCTION COST 988,019$ B. ESCO FEES IGA 98,122$ Design Fee [10% * (Total Construction Cost - Supervision - Reimbursibles - Safety)] 2.0%19,468$ Construction Mgmt. [6% * (Total Construction Cost - Bond - Supervision - Reimbursables - Safety)] 6%58,405$ Overhead [11%*(Total Construction Cost - Bond - Supervision - Reimbursibles - Safety)] 11%107,076$ Apprenticeship Incentive 1,000$ Profit [7%*(Total Construction Cost - Bond - Supervision - Reimbursibles - Safety)] 7%68,139$ TOTAL ESCO FEES 352,211$ C. OTHER COSTS Project Contingency 5.0%67,011$ ESCO M&V Costs (Year 1)3,000$ TOTAL OTHER COSTS 70,011$ D. TOTAL GUARANTEED CONSTRUCTION & ESCO SERVICES 1,410,241$ E. NON-GUARANTEED COSTS DES Fee 58,300$ Tax 8.9%119,547.43$ TOTAL NON GUARANTEED COSTS 177,847$ F. TOTAL PROJECT COST 1,588,088$ December 5, 2023 H - 14 10 3 Scope of Work TRANE identified opportunities to increase energy efficiency at the City of Port Angeles Facility during the course of the IGA. City of Port Angeles Staff have been heavily involved throughout the IGA and the resulting scope of work reflects short and long term goals of the City of Port Angeles. The detailed IGA concluded that the most effective way of meeting the City of Port Angeles’s objectives of promoting energy efficiency would be to implement the ECMs in this ESP. Energy Conservation Measures Narrative The proposed Energy Savings Performance Contract (ESPC) consists of the following Energy Conservation Measures (ECMs), which were prioritized based upon the results of the IGA and agreed upon by the Owner. Further detail on the scope of work is in Section 3.4 of this ESP. ECM-1 Senior Center HVAC Renewal The intent of this measure is to replace the existing system with new heat pumps and air handling systems. Trane used a load analysis to determine the sizes of new air handlers that are required. Given the limited access to the attic, Trane designed a system that relies on modular air handler units that will be connected together with duct work. The system will use the existing relief air duct as a mixing plenum where outdoor air will be added from an energy recovery ventilator. The measure will add a makeup air unit to provide 100% outdoor air to the kitchen. The measure would remove the existing DDC control system and install a new DDC system connected with hardwiring or Wi-Fi. The following order of precedence has been established for the scope of work documents in this ESP: 1) Preliminary Design Documents located in Section 7 of the IGA Report. 2) The Scope of Work Narrative located in this Section of this ESP. ESCO Services Trane will provide the following services related to this project: 1. ENERGY AUDIT The energy audit portion of this project is complete and can be found in the Investment Grade Audit report dated September 12, 2023. 2. DESIGN SERVICES Trane will provide design services as needed to construct the project and obtain permitting (mechanical, electrical, etc.), Owner review, and approval of the proposed system and to obtain competitive bids as appropriate for the project. In addition, Trane will also provide construction support services, start-up, testing and as-built drawings of systems installed both in electronic (MS Office and AutoCAD) and two full-sized hard paper copies to the Owner. December 5, 2023 H - 15 11 3. CONSTRUCTION Provide, or cause to be provided, all material, labor and equipment, including permits, fees, bonds and insurance, required for the complete and working installation of equipment. a. Trane will provide site resources that will be responsible for the onsite supervision and coordination of trades and subcontractors. These individual’s responsibilities will also include regular work observations, quality control, site security, enforcement of the site-specific safety plan, as well as coordinating any impact upon process or occupancy schedules with the Owner. b. Trane will provide site specific safety plan prepared and audited by our Environmental Health and Safety (EHS) Manager in addition to the site superintendent. c. Trane may perform portions of the construction work with the approval of the Owner and DES or may subcontract portions to qualified firms. In either case, Trane will share information regarding actual costs of the work with the Owner and DES. d. When Trane has completed the ECM, including start-up, operations verification and training in accordance with the proposal, DES and Trane will provide the Owner a “Notice of Substantial Completion” and “Notice of Commencement of Energy Savings.” e. At the conclusion of the project, DES and Trane will submit a “Notice of Final Completion” to the Owner. 4. CONSTRUCTION MANAGEMENT Trane will provide a construction manager who will provide contract administration services for the project. The Owner is expected to coordinate day-to-day communications with tenants and any scheduling of tenant relocations in and around occupied areas. 5. OPERATION TRAINING Trane will provide training of staff after startup and commissioning. This proposal includes training sessions for all major equipment and controls to be held at the project site. 6. MEASUREMENT AND VERIFICATION (M&V) Trane will provide measurement and verification to ensure that guaranteed savings are achieved throughout the term of the agreement. Additional on-going services shall be under separate agreement. Specific measurement and verification tasks associated with this project can be found in Section 4 of this ESP. 7. SYSTEM COMMISSIONING Refer to the Detailed Scope of Work in this section of the ESP for system commissioning requirements. 8. EQUIPMENT MAINTENANCE Trane will provide no equipment maintenance or repairs after the warranty period. Following the completion of the installation and acceptance by the Owner of the equipment, the Owner shall provide all necessary service, repairs and adjustments to the equipment so that the equipment will perform in the manner and to the extent set December 5, 2023 H - 16 12 forth in the proposal. Trane shall have no obligation to service or maintain the equipment after the warranty period. 9. WARRANTY Trane will warrant equipment, material, design, and workmanship for one year following receipt of client’s acceptance of “Notice of Commencement of Energy Savings” by ECM as outlined in Section 5.24 of ESPC General Conditions. Specific information regarding equipment warranty will be passed on to the Owner. 10. HAZARDOUS WASTE Should the project require removal or disposal of hazardous material, Trane will comply with section 5.20 of the ESP General Conditions. Prior to construction start, the Owner will provide to Trane their Hazardous Materials Survey or Good Faith Statement as to the presence of such materials. The costs for removal and disposal of any hazardous materials that have not been identified during the IGA and are discovered during construction are not included in the guaranteed maximum cost. The Owner agrees and acknowledges that it has not relied on or employed Trane to analyze or identify the presence of any hazardous substance on the Owner’s premises. Project Schedule Trane will develop a final Project Schedule once a Notice to Proceed has been received from the DES. Substantial completion is estimated within (400) calendar days after receipt of the Notice to Proceed from DES. Detailed Scope of Work Refer to the following ‘Detailed Scope of Work’ narrative located in this section of the ESP as well as the preliminary design drawings located in Section 7 of the IGA Report for further detail. The following order of precedence has been established for the scope of work documents in this ESP. 1) Preliminary Design Documents located in Section 7 of the IGA Report. 2) The Scope of Work Narrative located in this Section of this ESP. This project has multiple phases to allow for continuous occupancy by the staff, which is necessary due to the critical nature of this site and the need to conduct business as usual during construction. Applicable building, mechanical, energy or other pertinent state and local codes that may impact the project costs include: 1. International Energy Conservation Code 2020 Edition 2. State Building Code Adoption and Amendment of the International Mechanical Code, 2021 Edition 3. Washington State Energy Code 2021 Edition 4. State Building Code Adoption and Amendment of the Uniform Plumbing Code, 2018 Edition and Appendices A, B, and I. a. Excluding chapters 12 & 15 December 5, 2023 H - 17 13 b. Excluding Combustion Air and Ventilation of Appliances in Chapter 5 c. Excluding Portions of the Code Addressing Building Sewers 5. The National Electric Code, 2020 Edition, as published by the National Fire Protection Association Scope of Work ECM-1: Senior Center HVAC Renewal 1. Mechanical a. New Work i. Provide shipping destination and storage for all new HVAC equipment; Trane will purchase equipment ii. Install twelve (12) new TPVFYP054AM141A model air handling units in the attic mechanical room. 1. Include condensate pumps and seacoast coil coating 2. Provide and install ducting as shown on the schematic drawing M3.0 from the air handling units to all the supply ducts. 3. Reinstall three (3) existing bypass boxes iii. Install five (5) new LGH-F600RVX2-E model energy recovery ventilators in the attic mechanical room. 1. Provide and install ducting, louvers and dampers as shown on the schematic drawing M3.0 for outside air and exhaust air. iv. Install three (3) new Trane model TURY outdoor heat pumps on the existing concrete housekeeping pads. 1. Include mounting legs and seacoast coil coating v. Insulate new ductwork in accordance with 2018 WSEC Table 403.10.1.2. vi. Install three (3) new Trane model TCMBM0108JA11N4 branch control boxes. vii. Provide and install new refrigerant line sets, sized according to manufacturer’s recommendations, between the outdoor units, branch boxes, and indoor units. viii. Purge new line sets with nitrogen during all brazing operations. Patch and paint as necessary. ix. Charge refrigeration system with the correct quantity of R-410A. x. Insulate vapor line with ½” Armaflex elastomeric insulation. xi. Install three (3) new TPEFYP096OA140A model air handling units for use as kitchen makeup air units. xii. Provide and install support structure to hold the make-up section xiii. Provide and install ducting, dampers and louvers as shown on the drawings from outdoor air louvers to makeup air units and from the makeup air units down through two floors into the kitchen. Patch all holes in the ceilings, floors and walls that are necessary to install ducting 1. Provide and install new fire dampers where makeup air duct crosses rated fire walls or floors (e.g. floors, stairway and mechanical room) 2. Provide and install new low velocity, vertical flow diffusers on the makeup air duct termination, near the existing kitchen hoods b. Demolition i. Evacuate, capture and properly dispose of existing refrigerant. December 5, 2023 H - 18 14 ii. Remove and dispose of the outdoor condensing section of (4) existing Trane split air source heat pumps. The outdoor condensing sections are model number TWA120 and were manufactured in 1994. iii. Remove the existing R-22 refrigerant lines from the existing outdoor sections to the indoor split air handlers. Existing refrigerant lines run from the outdoor units, along the ground to the building, and then route up through a chase to the attic mechanical room. iv. Preserve and protect the existing exterior concrete housekeeping pad for re-use. v. Remove and dispose of the four (4) existing indoor Trane air handling sections. The indoor air handling sections are model number TWE120 and were manufactured in 1994. 1. Preserve and re-use four (4) existing smoke detectors 2. Preserve and re-use three (3) existing bypass boxes vi. Remove and dispose of the existing transfer fan (TF-1) in the dining room, cap abandon associated ductwork. vii. Remove and dispose of two (2) building relief fans (BRF-1 and BRF-2) viii. Preserve and re-use two (2) return fans (RF-1 and RF-2) 2. Controls a. Remove Barber Coleman controls system b. Provide and install new terminal Trane VAV controllers and space sensors for twenty-two (22) existing VAV boxes c. Provide and install one (1) SC+ d. Provide and install electrical circuit as necessary e. Provide and install communication wiring to: i. Three (3) new Trane outdoor heat pump units ii. Three (3) new Trane branch controller boxes iii. Fifteen (15) new Trane indoor air handlers iv. Five (5) new Trane Energy Recovery Venitlators f. Provide and install four (4) new Trane unitary controllers (UC200/UC400) and communication wiring from SC+ to each Trane heat pump (total 4 heat pumps) g. Design/Program/Startup/Commission/Checkout and install twenty-two (22) VAV box controllers and respective space sensors h. Design/Program/Startup/Commission/Checkout of i. new SC+, ii. Three (3) new Trane outdoor heat pump units iii. Three (3) new Trane branch controller boxes iv. Fifteen (15) new Trane indoor air handlers v. Five (5) new Trane Energy Recovery Venitlators vi. (22) VAV boxes i. Installation of Trane software including graphics, time of day scheduling, reporting, alarming. Customer to provide recommended PC platform j. Additional support from customer would include assistance of setting up customer IT department approved VPN and associated communications infrastructure k. Installation and registration of Trane factory software 3. Electrical a. Demolition i. Provide and install lockout-tagout as required. December 5, 2023 H - 19 15 ii. Remove and dispose of the (4) existing disconnects with 80A fuses on the existing outdoor heat pumps. Preserve wiring and conduit from the existing disconnects to the existing branch panels for later reuse. iii. Remove and dispose of the (4) existing 80A breakers in the existing branch panel 1B located in the first-floor electrical room. b. New Work i. Provide and install (1) new disconnect on each of three (3) new outdoor heat pumps. New disconnects will be rated for 208V 3-phase, with a 60A fuse for OUT-1 and 40 A fuses for OUT-2 and OUT-3. ii. Provide and install (1) new 60A breaker in branch panel 1B in the first floor electrical room for OUT-1 and (2) new 40A breakers in branch panel 1B for OUT-2 and OUT-3. iii. Provide and install additional breakers in existing panel M1 located in the mechanical penthouse for the equipment listed below (refer to note 1, sheet M4.3) 1. Indoor air handlers 2. ERVs 3. BC boxes 4. Testing and Balancing a. Total airflow through each new ASHP. This would include confirmation of proper pressure tests confirming operations and efficiencies b. Re-balance of twenty-two (22) VAV box controllers for proper cfm calibration. 5. Commissioning a. Functional testing will be performed during the startup of the four (4) heat pump controllers, startup of the SC+ and the twenty-two (22) VAV box controllers. b. Confirmation that graphics update with real-time data c. Confirmation that time of day scheduling is complete to the customer’s requirements Clarifications/Exclusions 1. Replacement of any equipment or system except those components specified above is not included. It is assumed that existing equipment to remain is functioning per City of Port Angeles staff, latest record drawings and manufacturer specs. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/9/2023. 2. This proposal is based on completing the work during normal working hours and does not include shift differential. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/9/2023. 3. This proposal is based on performing the work in accordance with the enclosed construction duration of 400 days and will require some service outages. During the course of the required outages Trane will work with the City of Port Angeles to maintain a healthy and safe environment. Due to the nature of the working environment and variability in daily flow, Trane makes no guarantees for events out of our control. 4. This proposal is based on preparations to purchase, receive, handle, and stage material on site as well as to place construction debris in a dumpster located on site by Trane if required. 5. This proposal does not include any extra equipment or materials. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/9/2023. December 5, 2023 H - 20 16 6. This proposal does not include hazardous material removal and/or abatement (asbestos, mold, lead, etc.). It is assumed that the City of Port Angeles will bear any costs associated with hazardous material identification and abatement. 7. Code upgrades other than those needed to complete the project are not included. 8. This proposal does not include any work on systems other than what is required for a complete installation and testing of the measures identified in this proposal. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/9/2023. 9. This proposal assumes that existing equipment and systems are currently under control, properly maintained and in good working order. This proposal does not include performance of any repairs or maintenance on said existing equipment. 10. This proposal does not include reinstallation of existing smoke detectors and reconnecting them to the existing fire alarm system. Trane discussed with the City that the City will use their own fire system contractor to re-attach the alarms and they agreed on 11/9/2023. December 5, 2023 H - 21 17 4 Energy and Performance Guarantee Savings and Project Incentives 4.1.1 Annual Utility Cost Savings ECM-1 will create guaranteed annual savings (90% of calculated) for City of Port Angeles: ECM-1: $2,838 (47,307 kWh) The 100% calculated annual savings from these reductions is: ECM-1: $3,154 (52,563 kWh) 4.1.2 Annual Maintenance/Operations Costs Impact The ECM in this proposal will result in annual maintenance and operation cost savings for City of Port Angeles as the upgrade includes new equipment. These O&M savings have not been quantified. Detailed Energy Calculations Please refer to Section 6 of the IGA report dated November 6, 2023 for further detail regarding energy savings calculations. Table 4.1 provides a summary of calculated and guaranteed energy savings by ECM. Energy Conservation Measure (ECM) Calculated kWh Savings (100%) Guaranteed kWh Savings (90%) ECM 1. Replace Sen Cen HPs, AHUs, + BAS 52,563 47,307 TABLE 4.1: SUMMARY OF SAVINGS BY ECM Utility Data Please refer to Section 5 of the IGA report dated November 6, 2023 for further detail regarding historical utility data for City of Port Angeles. Table 2 is a summary of annual energy usage for the 2 buildings. Table 3 defines the base and floor electrical utility rate used in this ESP and for the Guarantee Term. Building Annual electric (kWh) Annual electric cost Senior Center 311,040 $18,662 TABLE 4.2: ENERGY USE SUMMARY Building Utility Provider Electricity Cost ($/kWh) Electric Demand ($/kW) Senior Center City of PA $0.052 $4.50 TABLE 4.3: UTILITY RATE December 5, 2023 H - 22 18 Energy and Performance Guarantee SAVINGS GUARANTEE Trane guarantees that, as a result of Trane’s implementation of the ECMs detailed above, these ECMs will create a Total Energy Savings of 47,307 kWh (the “Guarantee”), in the twelve-month period following the Commencement Date. TOTAL ENERGY SAVINGS The energy savings shall be computed as specified in this ESP. Utilizing as-built documentation (drawings, startup logs, field measurements), and trend data, Trane will determine Total Energy Savings for the Guarantee Year by updating the energy calculations found in Section 6 of the IGA Report dated November 6, 2023. CONSTRUCTION/INTERIM PERIOD SAVINGS Energy savings accrued prior to the Commencement Date accrue for the sole benefit of the owner. COMMENCEMENT DATE AND GUARANTEE TERM The "Commencement Date” shall be the first calendar day of the month following the month in which the Date of Notice of Commencement of Energy Savings occurs. This Guarantee shall begin as of the Commencement Date and, unless this Agreement shall terminate earlier, shall expire either on the day immediately preceding the one-year anniversary of the Commencement Date (hereinafter the “Guarantee Term”), or the day the measurement and verification report has been submitted to the DES and client agency, whichever happens later. BASE UTILITY RATES The Base Utility Rates are those utility rates used in the Utility Baseline Analysis that are used to calculate the energy savings, and is the “District Wide” rate as set forth in Table 4.3 of this proposal. The Base Utility Rates used to calculate energy savings will be used as the floor price for the Guarantee Term and shall be the lowest rate used. ADJUSTMENTS Trane may make adjustments to the Baseline at its discretion and with the approval of DES and the Owner using standard and sound engineering principles to account for: a. Process/Building Changes (remodeling, addition of equipment, or change in usage or process): Customer agrees to contact Trane within fifteen (15) calendar days of commencement of any changes or additions of equipment or environments; and b. Data or other information newly discovered or otherwise not readily available at the time the Baseline was prepared; and/or c. Failure of Owner to perform its obligations outlined in this Section of the ESP. Should the owner fail to meet these obligations and depending upon the severity of failure as agreed upon by Trane and DES, the baseline may be adjusted, or the guaranteed energy savings deemed void. OWNER RESPONSIBILITIES Owner acknowledges that they have an integral role in achieving savings and agrees to perform the following responsibilities: December 5, 2023 H - 23 19 a. Properly maintain, repair, and replace all energy consuming equipment with equipment of equal or better energy and operational efficiencies and promptly notify Trane of the repair and /or replacement, but no later than within fourteen (14) calendar days from the commencement thereof; b. Make available to Trane upon its request copies of maintenance records and procedures regarding maintenance of the Premises; c. Promptly provide Trane with notice of system and building alterations at the Premises that impact energy consumption, including but not limited to: energy management systems, and heat recovery systems; d. Log any utility meters and the operation of any energy consuming devices or equipment as directed by Trane and furnish copies of such logs to Trane within thirty (30) calendar days after preparation of the logs; e. Provide to Trane true, accurate and complete descriptions of all energy consuming devices within fifteen (15) days after installation and startup of such equipment. The parties stipulate that, in each event that Owner fails to provide this information within thirty (30) days after the startup of such equipment, Customer shall be deemed to have realized that portion of the Total Energy Savings prorated for the utility billing period to which said energy related bill relates and for such subsequent utility billing periods as are affected by an increase in energy and/or demand use that could have been avoided had Trane been provided with the energy related information in a timely manner. In the event Trane subsequently receives or obtains the untimely energy related bill and such bill discloses that savings were achieved in an amount greater than had been stipulated hereunder, such greater savings will be used in calculating Actual Savings; f. Furnish to Trane true, accurate and complete copies of any utility rate schedules or tariffs promptly upon Trane’s request for the same and, in any event, within thirty (30) calendar days after Customer’s receipt of notice of a utility rate change; g. Maintain in effect and fully perform its obligations under the Maintenance Agreement throughout the duration of the Guarantee; and h. Provide access to trend data as outlined in this Section of the ESP EXCLUSIONS FROM TRANE’S RESPONSIBILITIES Unless caused by Trane or its subcontractors, Trane shall not be responsible for any of the following: a. Any shortfalls in Total Energy Savings or Operational Savings, failure to satisfy the Guarantee, or for loss, damage or malfunction to equipment, systems, controls or building(s) structures resulting from non-Trane personnel or its subcontractors examining, adjusting or repairing equipment, systems, or controls; b. Any damage or malfunction resulting from freezing, corrosion or erosion on the water side of the equipment or caused by scale or sludge on equipment; c. Problems or damages caused by utility service or damage sustained by equipment or systems; d. Outside of those items expressly written in the guarantee language and measurement and verification plan, Trane is not responsible for furnishing any equipment, materials, labor, or performing tests required by insurance companies, or federal, state, or local governments.; and e. Failure or inadequacy of any structure or foundation supporting or surrounding equipment or work or any portion thereof. December 5, 2023 H - 24 20 Measurement and Verification (M&V) Plan Trane’s measurement and verification (M&V) approach for this project is as follows: ECM-1. Senior Center: Upgrade HVAC IPMVP Method D AGREED UPON PARAMETERS Refer to Table 4.4, Measurement and Verification (M&V) Action Plan Outline in this section of the ESP and Section 6 of the IGA Report for a full listing of agreed upon parameters. APPLICABIILITY This performance guarantee applies to the ECMs listed above in the City of Port Angeles, Washington. EXISTING CONDITIONS Based on site visits, trend collection, review of record documents, interviews with owner staff, and engineering calculations the existing conditions have been defined in the ‘Measurement and Verification (M&V) Action Plan Outline’ in this section of the ESP and scope of work narrative and preliminary design drawings in this ESP. PRE-RETROFIT CONSUMPTION DATA Pre-retrofit power consumption data was calculated by Trane during the investment grade audit based on record documents and entire building trend data. Annual operational hours were established through TRACE 700 energy models. Refer to Section 6 of the IGA report for further detail regarding power consumption estimates and a summary of collected data. PRE-RETROFIT CONSUMPTION DATA AND MEASUREMENT METHODOLOGY A combination of site visits, field measurements, review of record documents, interviews with Owner staff, and engineering calculations were used to determine the baseline values for the variables listed in Table 4.4 of this ESP. POST-RETROFIT CONSUMPTION DATA AND MEASUREMENT METHODOLOGY A combination of trends to be collected via the BAS system and field measurements will be used to determine the post-retrofit values for the variables listed in Table 4.4 of this ESP. December 5, 2023 H - 25 City of Port Angeles Senior Center Ph. 1 HVAC TABLE 4.4 - MEASUREMENT AND VERIFICATION (M&V) ACTION PLAN OUTLINE STATUS: Phase 1 - Development ECM NAME FACILITY/ BUILDING KEY PERFORMANCE INDICATORS BASELINE VALUES PROPOSED VALUES INVESTMENT GRADE AUDIT TASKS POST-CONSTRUCTION (Cx) TASKS ANNUAL M&V TASKS YEAR 1 ONGOING OWNER RESPONSIBILITIES STIPULATED VARIABLES 1. Annual Cooling Load (Ton- hours)4,899 4,899 Cooling load determined through building simulation. Inputs for the building simulation determined through review of record drawings and O&M information, interviews with owner staff, and review of the building automation system schedule and setpoints. N/A - annual cooling load is assumed constant N/A - annual cooling load is assumed constant Maintain equipment according to manufacturer recommendations.Annual Cooling Load 2. Annual Heating Load (MMBTU)240 240 Heating load determined through building simulation. Inputs for the building simulation determined through review of record drawings and O&M information, interviews with owner staff, and review of the building automation system schedule and setpoints. N/A - annual heating load is assumed constant N/A - annual heating load is assumed constant Maintain equipment according to manufacturer recommendations.Annual Heating Load 3. OUT-1 Cooling Efficiency (COP)3.00 3.20 Review existing heat pump O&M information to determine baseline COP Review installed heat pump submittal information and startup report to ensure installed efficiency is within 10% of the COP listed in this Table Review installed heat pump submittal information and startup report to ensure installed efficiency is within 10% of the COP listed in this Table Maintain equipment according to manufacturer recommendations.Cooling Efficiency 4. OUT-2 + OUT-3 Cooling Efficiency (COP)3.00 3.49 Review existing heat pump O&M information to determine baseline COP Review installed heat pump submittal information and startup report to ensure installed efficiency is within 10% of the COP listed in this Table Review installed heat pump submittal information and startup report to ensure installed efficiency is within 10% of the COP listed in this Table Maintain equipment according to manufacturer recommendations.Cooling Efficiency 5. Controls Setpoints Varies Varies VAV boxes were examined and it was found that a number of the controllers no longer had power running to them. Review startup logs, commissioning report, and as-built controls drawings to ensure the intended programming is in place and functional. Review trend logs for a 30-day period to verify that occupied/unoccupied programming is functional. Maintain equipment according to manufacturer recommendations.NA ECM 1 Senior Center: HVAC Renewal Senior Center December 5, 2023 H - 26 IGA Report Prepared by: Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 November 13, 2023 City of Port Angeles Senior Center Energy Upgrades Phase 1: HVAC 328 E 7th St Port Angeles, WA 98362 DES Audit Agreement # 23-227 c/o Department of Enterprise Services 1500 Jefferson Street SE PO Box 41012 Olympia, WA 98504-1012 Website: www.des.wa.gov December 5, 2023 H - 27 1 CONTACTS Site Contact The following facility personnel assisted with this report: Corey Delikat Director of Parks & Recreation City of Port Angeles 308 East 4th Street Port Angeles, WA 98362 Direct: (360) 417-4551 Email: Cdelikat@cityofpa.us Department of Enterprise Services Contact The DES Project Manager (PM) is: Novella Randall Project Manager Washington State Department of Enterprise Services 1500 Jefferson Street Southeast Olympia, Washington 98501 Phone: 360-790-3667 E-mail: novella.randall@des.wa.gov Utility Contact Gregg King Power Resources Manager 321 E 5th St Port Angeles, WA 98362 Phone: 360-417-4710 E-mail: gking@cityofpa.us ESCO Contact Information The Energy Savings Company (ESCO) that prepared this report are: Greg Stinson Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 Phone: (425) 256-1717 E-mail: Greg.Stinson@tranetechnologies.com December 5, 2023 H - 28 2 Table of Contents 1 General Description ............................................................................................................. 3 2 Facility Description ............................................................................................................... 4 3 ECMs Considered But Not Proposed ................................................................................... 5 4 Infrastructure and O&M Recommendations ......................................................................... 6 5 Utility Data ........................................................................................................................... 7 6 Energy Savings Calculations & Pre-Retrofit Measurements ................................................. 8 7 Trace Energy Model ........................................................................................................... 10 8 Design Documents ............................................................................................................. 11 9 Diverse Business Enterprise Utilization .............................................................................. 12 December 5, 2023 H - 29 3 1 General Description Port Angeles is a City and county seat of Clallam County, Washington, United States. With a population of 19,960 as of the 2020 census, it is the largest city in the county. The population was estimated at 20,134 in 2021. Port Angeles has a warm summer Mediterranean climate. The climate is heavily moderated by the Pacific Ocean, resulting in cool summers and mild winters for its latitude. Summers are far cooler than those of nearby Seattle, though on June 27, 2021, Port Angeles set a new all-time record high of 97 °F (36 °C), breaking the city's previous all-time record high of 96 °F (36 °C). https://en.wikipedia.org/wiki/Port_Angeles,_Washington The City published a climate resiliency plan in June 2022. The plan will assist the City in directing measurable action to support system-wide waste and energy/water use reductions, sustainable land use, transportation and economic development, and social and environmental health and equity that celebrates the community’s diversity. The plan shifts the City’s focus by recognizing the importance of contributing to sustainability through public projects that connect trails and transit, commercial development that provides jobs and services to neighborhoods, and innovative Low Impact Development stormwater and building practices. The policies driving the City's future are informed by actions that have been identified as necessary steps to build community-wide climate resilience. https://www.cityofpa.us/1010/Climate-Resiliency-Plan https://www.cityofpa.us/DocumentCenter/View/11771/2022-Climate-Resiliency-Plan---Final The City government operates three main buildings, the Senior Center, Fire Station, and City Hall. There is no gas service to the buildings, electric is the only energy utility. December 5, 2023 H - 30 4 2 Facility Description Senior Center The Port Angeles Senior Community Center is located at 328 E 7th St, Port Angeles, WA 98362. It is a 16,000 square foot building that was completed in 1995 and is cooperatively run by the City of Port Angeles and the Senior Center Board of Directors. This beautiful multi- purpose facility offers a complete commercial kitchen, multi-purpose room, dining room, separate coffee lounge, computer room, meeting rooms, a crafts and activities room, game room, and poolroom. All programs and services are self-supporting, and the costs vary accordingly. The building’s operating hours are from 8 am – 5 pm Monday – Friday. The facility is closed on weekends and holidays. The building’s HVAC system is comprised of four (4) outdoor heat pumps installed with the original building. The outdoor compressors are connected separately to four (4) indoor air handling units. The air handling units have constant volume fans that are each connected to separate ducts that each serve different quadrants of the building on multiple floors. There are electric heaters in two of the ducts to provide supplemental heat. There are twenty-two (22) variable air volume (VAV) dampers located in the ducts to control airflow to individual zones. Each air handler has a bypass damper connecting its return and supply air. There are two return fans to draw return air back into the attic mechanical room. There is a grease fan that draws air out of the kitchen through a hood located above the stove tops. When the kitchen vent is not operating, a building relief fan located in the attic removes excess air from the building. Two of the four outdoor heat pumps are no longer operational and have been scavenged for parts to keep the other two heat pumps running. The mission of the Port Angeles Senior Center Board of Directors is to develop and manage programs to encourage physical, intellectual, emotional, and social well-being for citizens 45 and above in a safe and open environment. http://www.portangelesseniorcenter.com/mission.php December 5, 2023 H - 31 5 3 ECMs Considered But Not Proposed ECM-2 proposed installing three (3) new rooftop units at the Fire Station. The project will be completed as part of a separate ESP. ECM-3 proposed installing a solar array on the roof of the Senior Center along with a new battery to back up the power in case of an outage. The project received a state grant and will be completed as part of a separate contract. ECM-4 proposed installing a solar array on the roof of the Fire Station along with a new battery to back up the power in case of an outage. The project is on a waiting list to receive a state grant and will be completed as part of a separate contract. December 5, 2023 H - 32 6 4 Infrastructure and O&M Recommendations Refer to Section 3, ECMs Considered But Not Proposed, for other potential energy conservation measures to be implemented. December 5, 2023 H - 33 7 5 Utility Data Tables 5.1 and 5.2 shows the historical energy usage for the Senior Center and Fire Station. The average EUI for the past 4 years in the Senior Center is 15% more than the target EUI (EUIt) = 50 kbtu/year/sq ft for Social Meeting Halls as defined in the Washington State Clean Buildings law WAC 194-50. Month Electric Use (kWh) Electric Demand (kW) 2019 2020 2021 2022 Average 2019 2020 2021 2022 Average Jan 29,360 39,400 38,120 52,280 34,380 122 132 133 133 132 Feb 47,600 34,320 34,600 30,560 40,960 151 146 136 119 146 Mar 35,240 34,680 29,480 36,720 34,960 154 147 124 130 147 Apr 24,280 29,000 35,160 27,760 26,640 128 122 118 111 122 May 21,560 18,600 15,240 20,920 20,080 96 104 118 89 104 Jun 22,800 15,880 16,400 20,680 19,340 75 69 79 65 72 Jul 21,560 16,640 15,320 16,120 19,100 77 62 66 63 70 Aug 21,360 12,320 13,840 23,720 16,840 78 52 72 72 65 Sep 18,840 16,560 15,680 15,000 17,700 73 70 54 59 71 Oct 21,680 17,120 20,240 15,520 19,400 100 102 83 78 101 Nov 30,760 30,200 21,880 34,200 30,480 106 114 90 112 110 Dec 28,040 34,280 29,000 31,160 118 124 88 121 Total 323,080 299,000 284,960 293,480 311,040 1,280 1,243 1,159 1,030 1,261 Tot (kBtu) 1,102,349 1,020,188 972,284 1,001,354 1,061,268 126,090 Total Energy Use in kBtu 1,061,268 Energy Use Index (kBtu/sqft/yr) 57.6 TABLE 5.1: HISTORICAL SENIOR CENTER ENERGY USE December 5, 2023 H - 34 8 6 Energy Savings Calculations & Pre- Retrofit Measurements Trane analyzed four years of utility bills for the Senior Center and Fire Station. Trane created an energy model for the buildings using Trace 700. Based on the available electric utility data, Trane was able to estimate building occupancy, process loads, lighting loads, and equipment run time for each building. The results are summarized in Table 6.1. Energy Conservation Measure (ECM) Baseline (KWh/yr) Proposed (KWh/yr) Calculated Electric Savings (100%) Guaranteed Electric Savings (90%) ECM 1. Replace Sen Cen HPs, AHUs, + BAS 304,830 252,267 52,563 47,307 TABLE 6.1 SUMMARY OF SAVINGS FROM ECM Figure 6.1 shows how electricity usage varies from month to month for the Senior Center. The average electricity consumption is shown as a black dashed line in the left panel. The utility data (solid lines, one for 2019, 2020, 2021, and 2022) show electric usage peaks during the winter. Trace’s baseline model (dotted blue line) shows slightly lower winter peaks than the data and slightly higher summer consumption with less extreme peaks. The proposed model (dotted orange) shows less electric usage in the winter due to the more efficient new heat pumps. The controls measure reduces the runtime of the building equipment. Figure 6.2 shows that EEM-1 decreases electric consumption. EEM-1 is modeled using the same process and lighting loads as the baseline. The electric savings come from the increased efficiency of the heat pump system: FIGURE 6.1: HISTORICAL SENIOR CENTER ELECTRIC USAGE COMPARED WITH THE BASELINE AND ECM-1 ENERGY December 5, 2023 H - 35 9 Table 6.2 summarizes the electric savings the Senior Center HVAC upgrade will provide. The controls and VRF system will take the Senior Center below the EUI target set out in Washington States Building Performance Laws. Year Electricity (kWh) Total (MMBtu) Electricity Cost ($) EUI (kbtu/ft2) Measured Values 311,040 1,061 $18,662 57.6 Baseline model 304,830 1,040 $18,290 56.5 ECM-1 252,267 861 $15,136 46.8 Savings 52,563 179 $3,154 TABLE 6.2: SUMMARY OF ELECTRICITY AND UTILITY COST SAVINGS FOR ECM-1 FIGURE 6.2: ANNUAL SENIOR CENTER ELECTRIC CONSUMPTION December 5, 2023 H - 36 10 7 Trace Energy Model The inputs and outputs from the Trace Energy Model created for the Senior Center and Fire Station can be found in individual zip files that are attached to this report as an appendix. December 5, 2023 H - 37 11 8 Design Documents December 5, 2023 H - 38 MITSUBISHI ELECTRIC TRANE HVAC US: CITY MULTI VRF OUTDOOR UNIT SCHEDULETag Reference M-NET Address Model NumberModules Capacity (BTU/h) Capacity (BTU/h) Outdoor Temp Outdoor Temp Voltage / PhaseMCA 208/230 or [460V]RFSMOCPKitchen Makeup Air OUT-1 51, 52TURYE2883BN40AB 208/230V / 3-phase 3-wire 49/45, 49/45 60/60, 60/60 80/70, 80/70 P144, P144 288,000 320,00086.020.061.41-1/8 / 1-3/8 277,203.9 294,569.9 1, 2, 3, 4, 5AHU-1 & AHU-4OUT-2 54, 55TURYE2163BN40AB 208/230V / 3-phase 3-wire 41/38, 31/29 60/60, 45/45 60/60, 45/45 P120, P96 216,000 243,000 86.020.050.07/8 / 1-1/8 206,155.5 215,476.8 1, 2, 3, 4, 51st Flr & 2nd Flr East VRF OUT-3 58TURYE1203AN40AN 208/230V / 3-phase 3-wire 41/3860/6060/60P120120,000 135,000 86.020.062.03/4 / 1-1/8 112,060.3 119,845.2 1, 2, 3, 4, 52nd Flr VRFOUT-4 66TURYE0963AN40AN 208/230V / 3-phase 3-wire 31/2945/4545/45P9696,000108,000 86.020.081.03/4 / 7/8 92,044.3 96,206.2 1, 2, 3, 4, 5Notes & 1 Nominal cooling capacities are based on indoor coil EAT of 80/67°F (DB/WB), outdoor of 95°F (DB)2 Nominal heating capacities are based on indoor coil EAT of 70°F (DB), outdoor of 43°F (WB)3 Efficiency values for EER, IEER, COP are based on AHRI 1230 test method for mixture of ducted & non-ducted indoor units.4 For systems with multiple modules, refrigerant pipe dimensions indicate total system combined piping downstream of module twinning.5 Added field charge listed is in addition to factory charge, this must be updated based upon final as-built piping layout.MITSUBISHI ELECTRIC TRANE HVAC US: CITY MULTI VRF INDOOR UNIT SCHEDULECorrected CapacitySystem TagRoom Name Tag Reference Electrical MCA/MFS PanelCircuitModelTypeNominal Cooling Capacity (BTU/h)Nominal Heating Capacity (BTU/h)Cooling Design Entering Temp DB/WB (°F) / [Water in temp]Heating Design Entering Temp DB/WB (°F) / [Water in temp]Cooling Diversity Full/Partial (See Note 5, 6)Cooling Total Capacity (BTU/h)Cooling Sensible Capacity (BTU/h)Heating Diversity Full/Partial (See Note 5, 6)Heating Capacity (BTU/h)Refrig Pipe Dim Liquid/Suction (inch)Fan Speed SettingPeak Fan Airflow (cfm) / [Design gpm G(US)/min]Max Fan ESP Setting 208V/230V (IN WG)Voltage / Phase Notes / OptionsKitchen Makeup Air Makeup Air MAU-14.80/4.30/15 M126 40AUnit69,40177,69686.0/68.0 21.0/20.0FULL DEMAND69,262.5 45,305.1FULL DEMAND77,540.6 3/8 / 7/8 HIGH1200 1phase1, 2, 3, 4Kitchen Makeup Air Makeup Air MAU-24.80/4.30/15 M126 40AUnit69,40177,69686.0/68.0 21.0/20.0FULL DEMAND69,262.5 45,305.1FULL DEMAND77,540.6 3/8 / 7/8 HIGH1200 1phase1, 2, 3, 4Kitchen Makeup Air Makeup Air MAU-34.80/4.30/15 M126 40AUnit69,40177,69686.0/68.0 21.0/20.0FULL DEMAND69,262.5 45,305.1FULL DEMAND77,540.6 3/8 / 7/8 HIGH1200 1phase1, 2, 3, 41st Flr & 2nd Flr East VRF Lobby2.88/151CX44AConcealed 30,00034,00075.0/62.0 70FULL DEMAND27,555.8 21,881.6FULL DEMAND29,656.0 3/8 / 5/8 HIGH883 0.6/0.6phase1, 2, 3, 41st Flr & 2nd Flr East VRF Coffee Bar4.38/151CX44AConcealed 48,00054,00075.0/62.0 70FULL DEMAND44,089.3 34,037.0FULL DEMAND47,100.7 3/8 / 5/8 HIGH1306 0.6/0.6phase1, 2, 3, 41st Flr & 2nd Flr East VRF Copy Room0.24/0.24/15 1CX0A(Four-Way) 5,0005,60075.0/62.0 70FULL DEMAND4,592.64,440.7FULL DEMAND4,884.51/4 / 1/2 HIGH280phase1, 2, 3, 41st Flr & 2nd Flr East VRF Director0.24/0.24/15 1CX0A(Four-Way) 5,0005,60075.0/62.0 70FULL DEMAND4,592.64,440.7FULL DEMAND4,884.51/4 / 1/2 HIGH280phase1, 2, 3, 41st Flr & 2nd Flr East VRF Conference0.28/0.28/15 1CX0A(Four-Way) 8,0009,00075.0/62.0 70FULL DEMAND7,348.26,300.8FULL DEMAND7,850.11/4 / 1/2 HIGH315phase1, 2, 3, 41st Flr & 2nd Flr East VRF Director0.28/0.28/15 1CX0A(Four-Way) 8,0009,00075.0/62.0 70FULL DEMAND7,348.26,300.8FULL DEMAND7,850.11/4 / 1/2 HIGH315phase1, 2, 3, 41st Flr & 2nd Flr East VRF Conference2.13/15M128 44AConcealed 12,00013,50075.0/62.0 70FULL DEMAND11,022.3 8,471.6FULL DEMAND11,775.2 1/4 / 1/2 HIGH371 0.6/0.6phase1, 2, 3, 41st Flr & 2nd Flr East VRF Health1.75/15M128 44AConcealed 6,0006,70075.0/62.0 70FULL DEMAND5,511.25,511.2FULL DEMAND5,844.01/4 / 1/2 HIGH300 0.6/0.6phase1, 2, 3, 42nd Flr VRFBilliards0.54/0.43/15 M128 41B(Four-Way) 18,00020,00075.0/62.0 70FULL DEMAND16,663.4 14,721.8FULL DEMAND17,982.5 1/4 / 1/2 HIGH812phase1, 2, 3, 42nd Flr VRFArts and Crafts2.94/15M128 44AConcealed 18,00020,00075.0/62.0 70FULL DEMAND16,663.4 13,957.6FULL DEMAND17,982.5 1/4 / 1/2 HIGH600 0.6/0.6phase1, 2, 3, 42nd Flr VRFCard Room2.88/15M128 44AConcealed 24,00027,00075.0/62.0 70FULL DEMAND22,217.8 19,546.1FULL DEMAND24,276.3 3/8 / 5/8 HIGH883 0.6/0.6phase1, 2, 3, 42nd Flr VRFCorridor2.94/15M128 44AConcealed 18,00020,00075.0/62.0 70FULL DEMAND16,663.4 13,957.6FULL DEMAND17,982.5 1/4 / 1/2 HIGH600 0.6/0.6phase1, 2, 3, 42nd Flr VRFOffice2.94/15M128 44AConcealed 18,00020,00075.0/62.0 70FULL DEMAND16,663.4 13,957.6FULL DEMAND17,982.5 1/4 / 1/2 HIGH600 0.6/0.6phase1, 2, 3, 4Notes & 1 Nominal cooling capacities are based on indoor coil EAT of 80/67°F (DB/WB), outdoor of 95°F (DB)2 Nominal heating capacities are based on indoor coil EAT of 70°F (DB), outdoor of 43°F (WB)3 See outdoor unit schedule for outdoor ambient conditions, connected capacity, and other factors associated with corrected capacities4 See schematic piping/control diagram for indication of required indoor unit remote controllers, system controllers, and integration devices.5 Full demand corrected capacity includes de-rate associated with indoor vs. outdoor connected capacity indicated on outdoor unit schedule for associated system.Partial corrected capacity assumes sufficient diversity exists such that the connected capacity de-rate does not apply.It is the designer's responsibility to ensure "Diamond System Builder" is set in the appropriate output capacity setting (full demand/partial demand) prior to generating this schedule.6 It is recommended to always base heating corrected capacity on full demand.ERV-1F600RVX2-E Stand-Alone Cross Plate 6000.8667.0%50.0%64.0%phase5.2/151, 2, 3ERV-2F600RVX2-E Stand-Alone Cross Plate 6000.8667.0%50.0%64.0%phase5.2/151, 2, 3ERV-3F600RVX2-E Stand-Alone Cross Plate 6000.8667.0%50.0%64.0%phase5.2/151, 2, 3ERV-4F600RVX2-E Stand-Alone Cross Plate 6000.8667.0%50.0%64.0%phase5.2/151, 2, 3ERV-5F600RVX2-E Stand-Alone Cross Plate 6000.8667.0%50.0%64.0%phase5.2/151, 2, 3123Kitchen Makeup Air BC-153BVMain8208,203.8 phase11AHU-1 & AHU-4BC-256TCMBM0108JA11N4 Main8216,000.0 phase111st Flr & 2nd Flr East VRF59TCMBG0108SJ11N4 Single8122,000.0 phase112nd Flr VRF67TCMBG0106SJ11N4 Single696,000.0 phase1112Include Diamondback Ball Valves BV-Series, 700PSIG working pressure, full port, 410A rated.For sub BC controller CMB-P-NU-GB1 or -GB, the total connectable indoor unit capacity can be 126,000 BTUs or less. If two sub BC controllers are used, the total indoor unit capacity connected to BOTH sub BC controllers also cannot exceed 126,000 BTUs. For sub BC controller CMB-P1016NU-HB1 the total connectable indoor unit capacity can be 126,000 BTUs or less. However, if two sub controllers are used, and one of them is CMB-1016NU-HB1, the total indoor unit capacity connected to BOTH sub controllers must NOT exceed 168,000 BTUs.Number of PortsConnected Capacity to BC Voltage / Phase MCA 208/230 Notes / OptionsNotes & Options:Notes & Options:Max external static pressure is at airflow listed with fan set on extra high speed.See schematic piping/control diagram for indication of required lossnay local remote controller (stand alone operation) and M-NET connection points of associated systems.Washable factory standard pre-filter on return and O/A intake side of cross plate core.VRF HEAT RECOVERY BRANCH CIRCUIT CONTROLLERSystem Tag Tag Reference M-NET Address Model Number Type (double / Main / Sub)Voltage / Phase MCA / MOCP Notes / OptionsTemperature Recovery Enthalpy Cooling Enthalpy HeatingNotes / Options208/230 or [460V]LOSSNAY ENERGY RECOVERY VENTILATOR SCHEDULELossnay Tag Model NumberInterlocked or Stand Alone Core Type Nominal Airflow (cfm) Max ESP (INWG)Nominal Recovery Effectiveness (Extra High Fan Speed)System TagElectrical-Per ModuleMax Pipe Length from BC or 1st Joint (feet)Refrig Pipe Dim High/Low Pressure (inch) (See Note 4)Corrected Cooling Total Capacity (BTU/h)Corrected Heating Capacity (BTU/h)December 5, 2023 H - 39 ECM-1: SENIOR CENTER, VRF AND MAKEUP AIR UNIT RETROFITREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDESHEET INDEXSCALE: NONEG0.0TITLE PAGEG0.05PROJECT LOCATION - PORT ANGELES, WASCALE: NONEG0.03WORK AREASCALE: NONEG0.02NNCITY OF PORT ANGELESSENIOR CENTERAPPLICABLE CODESSCALE: NONEG0.01BUILDING ELEVATIONSCALE: NONEG0.04CITY OF PORT ANGELESPREPARED BYCOVENANT ENGINEERING33711 HWY 95LEWISTON, ID 83501208-792-1904GENERAL CONTRACTORTRANE2333 158TH COURT NEBELLEVUE, WA 98008425-643-4310ENERGY CONSERVATION MEASURESCOREY DELIKATDIRECTOR321 E 5TH STREETPORT ANGELES, WA 98362360-417-4550G0.04SENIOR CENTERDecember 5, 2023 H - 40 RETURN AIREXHAUST AIRFIRE DAMPERSQUARE FEET)BACKDRAFT DAMPERREQUIRED INDICATED IN DOOR LOWER (FREE AREAUNDERCUT DOORDLUCFBE REMOVEDAIR DEVICE TONUMBERNUMBERSINGLE LINESIZECFMCFMSIZESUPPLY AIRRADIUS ELBOW (R=1.5)CONTROL DAMPER-PARALLEL BLADEOPPOSED BLADECONTROL DAMPER-REGISTER (R) OR GRILLE (G)CEILING RETURN/EXHAUSTGRILLE (G) OR REGISTER (R)RETURN AND/OR EXHAUST AIRAIR REGISTER (R)SUPPLY AIR GRILLE (G) OR SUPPLYCFMSIZENUMBERCFMSIZECFMNUMBERSIZEFLEXIBLE CONNECTION (FXC)AIR FLOWRISE OR DROP DIRECTION OFBRANCH DUCT TAKE-OFFVANED ELBOWDIFFUSERCFM/BLOWSIZETO BE REMOVED.EXISTING EQUIPMENT OR DUCTWORKACCESS DOORMOTOR OPERATED DAMPER (MOD)MANUAL VOLUME DAMPER (MVD)NEW DUCTWORKEXISTING DUCTWORK TO REMAINADVDADDOUBLE LINEDUCTWORK SYMBOLSSIZECFMDRCFM/BLOWSIZEADVDCWPLEAVING AIR TEMPERATURELATUNIT HEATERWET BULBUNLESS OTHERWISE NOTEDVARIABLE AIR VOLUME UNITWIRE MESH SCREENVENT THRU ROOFVOLUME DAMPEREXPANSION JOINTDUCT SILENCEREXHAUST FANDRY BULBEXHAUST REGISTERENTERING AIR TEMPERATUREELECTRICAL CONTRACTORDOMESTIC WATER PUMPEREATEJEFECDSDWPDBLEAVING WATER TEMPERATUREMOTOR OPERATED DAMPERMECHANICAL CONTRACTORMUALINEAR DIFFUSERMOUNTEDLINEAR FEETMAKE-UP AIR UNITMODMTDMCLFLDLWTVDWBWMSVTRVAVUONUHNECKOUTSIDE AIROUTSIDE AIR TEMPERATUREOUTSIDE AIR INTAKENORMALLY CLOSEDNOT IN CONTRACTNORMALLY OPENON CENTEROPPOSED BLADE DAMPERPARALLEL BLADE DAMPERPRESSURE REDUCING VALVEOUTSIDE DIAMETERPACKAGED TERMINAL AIR CONDITIONERREHEAT COILRETURN FANSUPPLY AIRREFLECTED CEILING PLANRETURN AIR GRILLERETURN AIR REGISTERSUPPLY AIR REGISTERTYPICALSUPPLY FANSMOKE EXHAUST FANSMOKE CONTROL GRILLESTATIC PRESSURETRANSFER GRILLESMOKE DAMPERRETURN AIRCONDENSATE PUMPCEILING DIFFUSERCLEAN OUTCHILLERCONDENSING UNITCOOLING TOWERCONDENSER WATER SUPPLYCONDENSER WATER RETURNCHILLED WATER SUPPLYCHILLED WATER RETURNCONDENSER WATER PUMPCONSTANT VOLUME BOXCABINET UNIT HEATERCUBIC FEET PER MINUTECHILLED WATER PUMPCVBCUHCUCWSCTCWRCHWPCHWSCOCPCHWRCDCFMCACOUSTICAL LININGAIR HANDLING UNITACCESS DOORBOTTOM OF BEAMBACK DRAFT DAMPERBOTTOM OF PIPEBOTTOM OF DUCTACCESS PANELAIR HANDLER (SPLIT REFRIG)BELOW FINISHED CEILINGELECTRIC BASEBOARD RADIATIONABOVE FINISHED FLOORAIR CONDITIONING UNIT APBOPBODBOBBFCBBDDBBBOILERALAHUAHAFFADACRAFINNED TUBE RADIATIONHEATING AND VENTILATING UNITHEATING HOT WATER RETURNHEATING HOT WATER SUPPLYHEAT EXCHANGERINSIDE DIAMETERHOT WATER PUMPHOT WATER CONVERTERHZIDHXHERTZHWRHWSHWPHWCHAND DAMPERHEAT PUMPGENERAL CONTRACTORGALLONS PER HOURGALLONS PER MINUTEGPMHPHVHDGPHGCFTRSARSFTYPTGSPSDSEFSCGSARHCRFRARRCPRAGEXTERNAL STATIC PRESSUREENTERING WATER TEMPERATUREELECTRIC WATER COOLERFAN COIL UNITFCFIRE DAMPERFLAT ON TOPFLAT ON BOTTOMFUEL OIL PUMPFIRE PUMPFEET PER MINUTEFPMFPFOPFOTFOBFLRFDFLOOREXPANSION TANKFREE AREAFLEXIBLE CONNECTIONFAFXEWCEWTETESPPRVPTACPBDOBDODOCOAIOATNKOANONICNCHVAC ABBREVIATIONSSUPPLY AIR, THROUGH FLOORCONTROL SYMBOLSDESCRIPTIONDISCONNECT SWITCHCONTROL TRANSFORMERCLOSED CONTACTSTHERMAL OVERLOADHAND-OFF-AUTOSELECTOR SWITCHWIRING CONNECTIONON-OFF SELECTOR SWITCHROOM TEMPERATURE SENSORWIRING DESIGNATION. (NO. OF HATCHESSTRAP-ON TEMPERATURE SENSORINDICATES NO. OF CONDUCTORS)NORMALLY OPEN AND NORMALLYROOM HUMIDITY SENSORFIBER OPTIC INTERFACEROOM AIR QUALITY SENSORPNEUMATIC RESTRICTORAIR FLOW MONITORING STATIONPILOT LIGHT (WITH LENS COLOR)ROOM TEMPERATURE SENSORWITH SETPOINT ADJUST ANDOVERRIDEROOM TEMPERATURE SENSORWITH GUARDNEW DIGITAL CONTROL STATIONDUCT AIR QUALITY SENSORPNEUMATIC TO CURRENTPNEUMATIC HIGH / LOWSIGNAL SELECTORIP#OMILS#LIMIT SWITCHTRANSDUCERWATER FLOW SWITCHMAIN AIR SUPPLYCURRENT SENSORDAMPER ACTUATORFOIRHDCSADIFFERENTIAL PRESSUREELECTRIC-PNEUMATIC RELAYPNEUMATIC-ELECTRIC SWITCHCURRENT TO PNEUMATICTHREE WAY CONTROL VALVETWO WAY CONTROL VALVESP#SP=NOCPNCPE#IP#OMIMTRANSDUCERINONCCEP#SMOKE DETECTORON-OFFDDC POINT DESCRIPTORTEMPERATURE SENSOR WITHLOW TEMPERATURE SWITCHHIGH TEMPERATURE SWITCHWITH AVERAGING ELEMENT(FIRESTAT)(FREEZESTAT)TEMPERATURE SENSORWITH PIPE WELLHUMIDITY SENSORSYMBOLTEMPERATURE SENSORSINGLE POINT ELEMENTDESCRIPTIONWITH NAMEAI - ANALOG INPUTAO - ANALOG OUTPUTDO - DIGITAL OUTPUTDI - DIGITAL INPUTAUTOOFFHANDOLFUSEVOLTAGE2VOLTAGE1SYMBOLRELAY COILSWDWATER DETECTORDESCRIPTIONNAME AIAODESCRIPTIONNAMETT-#TT-#TT-#HT-#FZ-#FS-#SD-#DP-#D#MFS-#CO2TSGTSOTTT-#R #EP #R #-#R #-#STACK/VENT THRU ROOF NUMBERSHEET NOTE NUMBERPLANS & PIPING DIAGRAMSCONNECT NEW TO EXISTINGTERMINATION POINT OF DEMOLITIONPOINT OF BEAM PENETRATIONCONNECT TO MANUFACTURER'SPREPIPED CONNECTIONPREPURCHASED EQUIPMENT(NUMBER)LOCATION POINT FORINDICATES REVISION & NUMBERCOORDINATION BETWEEN FLOORXXSECTION APPEARSINDICATES PIPE SIZEINDICATES RISER DESIGNATIONINDICATES SECTION NUMBERINDICATES ON WHICH DRAWINGXXXXEQUIPMENT IDENTITYEQUIPMENT NUMBEREQUIPMENT (SEE SCHEDULE)ON DRAWINGS)DETAIL APPEARSINDICATES DETAIL LETTER(APPLIES ONLY WHERE INDICATEDINDICATES DRAWING ON WHICHXXXABBREVIATIONREFERENCE SYMBOLSXXV#V#CNCNOSTORM WATERSPRINKLER PIPESTSPSANITARY DRAINDOMESTIC HOT WATER RECIR. (HWR)DOMESTIC HOT WATER (HW)DOMESTIC COLD WATER (CW)SANITARY VENTSANVHWCWHWRGSPRINKLER HEADFLEXIBLE-CONNECTIONSTRAINER WITHBLOW OFF VALVESTRAINERTPRELIEF VALVETEMPERATURE AND PRESSURERELIEF/SAFETY VALVEGAS PRESSURE REGULATORGAS COCKSOLENOID VALVEGLOBE VALVE, ANGLETHREE WAY CONTROL VALVETWO WAY CONTROL VALVEVALVE IN RISE OR DROPSWING CHECK VALVELIFT CHECK VALVEGATE VALVE, ANGLEBALL VALVEGLOBE VALVEPLUG VALVEVALVE (PRV)BUTTERFLY VALVE PRESSURE REDUCINGGATE VALVE(REDUCED ZONE)WALL CLEAN OUTCOCOBACKFLOW PREVENTORWATER HAMMER ARRESTERCIRCUIT SETTINGBALANCING VALVE(DOUBLE CHECK VALVE ASSEMBLY)OPEN SITE DRAINADRFDCOOSRDAREA DRAINCLEANOUTFLOOR DRAINROOF DRAINCBVHBSAHOSE BIBBPIPE RISING UPPIPE DROPPING DOWNTEMPERATURE TRANSMITTERPRESSURE TRANSMITTER ORPRESSURE SWITCHUNION - SCREWED OR FLANGEDGAUGE WITH GAUGE COCK/PRESSURE INDICATORBACKFLOW PREVENTORTHERMOMETER/TEMPERATUREPI/GATH/TIPT/PSINDICATORTTFSFLOW SWITCHPIPING ELEMENTS/VALVINGFCOFLOOR CLEAN OUTPIPE CAPPUMPPIPE CONTINUEBALANCING VALVEOXYGENO2NATURAL GASNITROUS OXIDEN20AIR (DENTAL)AIRVACUUM (DENTAL)VACCOLD WATER (DENTAL)DEN CWMETER, INLINEMM0.0LEGEND AND SYMBOLSREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDEDecember 5, 2023 H - 41 REVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDEGENERAL NOTES - HVACNOT TO SCALEM1.0GENERAL NOTES - HVACM/E1.01December 5, 2023 H - 42 REVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDEGENERAL NOTES - PLUMBING AND PIPINGNOT TO SCALEM1.1GENERAL NOTES - PLUMBING AND PIPINGM/E1.11December 5, 2023 H - 43 M2.0EQUIPMENT SCHEDULESREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDEINDOOR UNIT SCHEDULESCALE: NONEM2.01OUTDOOR UNIT SCHEDULESCALE: NONEM2.02December 5, 2023 H - 44 M2.1EQUIPMENT SCHEDULESREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDEENERGY RECOVERY VENTILATOR SCHEDULESCALE: NONEM2.11BRANCH BOX SCHEDULESCALE: NONEM2.12December 5, 2023 H - 45 2BCRAR410A3-1INRAR410A3-2INRAR410A3-3INRAR410A3-4INSARAR410ALOBBY / CRAFTS1-1INSARAR410A1-2INSARAR410A2-1INSARAR410A2-2INSARAR410A2-3INMECH ROOMRASA3ERVCO2GPSSDKITCHEN / DININGSDMUAEA3 (E)EFEA2 (E)EF3MAUOFFICESSATSDSASASARAR410A4-1INRAR410A4-2INRAR410A4-3INSASASAMULTIPRUPOSETSDRASA2ERVRASA1ERVRASA4ERVRASAEAOA5ERV1 (E)RFEAOAEAOAEAOAEAOA2 (E)RFBRANCH BOX(8 ZONE)R410AMUA2MAUMUA1MAUR410AR410ABRANCH BOX(8 ZONE)BRANCH BOX(8 ZONE)2OUT3BC3OUT1BC1OUTM3.0HVAC SCHEMATICREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDEHVAC SYSTEM SCHEMATICSCALE: NONEM3.01SHEET NOTES1PROVIDE AND INSTALL NEW THERMOSTATS? ... VVT RESETS SATEMP, VRF UNITS CONTROL TO SA TEMP12PROVIDE AND INSTALL ADJUSTABLE CO2 SWITCH IN RETURN AIRDUCT AND INTERLOCK WITH ERV OPERATION, SET TO 900 PPM (ADJ)23PROVIDE AND INSTALL MOTOR OPERATED ISOLATION DAMPER FOROA AND EA, INTERLOCK WITH ERV OPERATION, RUSKIN CD-40 WITHBELIMO ELECTRONIC ACTUATOR (OR EQUAL), TYP EACH ERV34RE-USE (RELOCATE AS NECESSARY) EXISTING SMOKE DETECTOR INCOMMON SUPPLY HEADER, INTERLOCK WITH FAN OPERATION, TYPEACH ZONE11145MAINTAIN AND RE-USE EXISTING RETURN AIR FANS, TYP 256PROVIDE AND INSTALL GRAVITY BACKDRAFT DAMPER FOR SA, TYPEACH INDOOR UNIT PRIOR TO ENTERING SA HEADER67RE-USE (RELOCATE AS NECESSARY) EXISTING VVT BYPASS BOXES,TYP 373,600 CFM,24" round3,600 CFM,24" round3,000 CFM,22" round19x2319x2319x2319x2319x2319x2319x234,500 CFM,26" round16x2016x2016x2016x2016x2016x2016x2016x2016x2016x2016x2016x2017x4417x4417x4414x4414x4414x4414"round14"round16"round6,000 CFM,30" round4,500 CFM,26" round10"round,typ10"round,typ4,000 CFM,24" round(E) RELIEFDUCTDecember 5, 2023 H - 46 OUT1OUT2OUT33OUT3OUT2OUT2OUT11OUT////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////M4.1FIRST FLOOR, SENIOR CENTERREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDESENIOR CENTER FIRST FLOORM4.11SHEET NOTES1BID AS ADD ALT: PROVIDE AND INSTALL NEW LINEAR SLOTDIFFUSERS OVER WINDOWS, CONNECT TO EXISTING DUCT, TYP 4N12DEMOLISH AND REMOVE EXISTING TRANSFER FAN, RECONNECTDUCT3DEMOLISH AND REMOVE EXISTING DIFFUSER AND DUCT LEADER2334PROVIDE AND INSTALL NEW ELECTRICAL FEEDERS AND CONDUITBETWEEN NEW OUTDOOR UNIT AND PANEL M1 IN PENTHOUSE,REPLACE EXISTING 100A BREAKER AT CIRCUIT 2, 4 & 6 AND EXISTING40A BREAKER AT CIRCUIT 8, 10 & 12 WITH TWO NEW 3-PHASEBREAKERS ACCORDING TO EQUIPMENT MOCP45PROVIDE AND INSTALL NEW ELECTRICAL FEEDERS AND CONDUITBETWEEN NEW OUTDOOR UNIT AND PANEL 1B IN ROOM 112,REPLACE EXISTING 80A BREAKERS FOR HEAT PUMPS HP-1 THOUGHHP-4 WITH TWO NEW 3-PHASE BREAKERS ACCORDING TOEQUIPMENT MOCP556TERMINATE NEW MAKEUP AIR DUCT NEAR KITCHEN HOOD(S) WITHLOW VELOCITY, VERTICAL FLOW DIFFUSER(S)67DEMOLISH AND REMOVE EXISTING REFRIGERANT LINE SETS75Not sure where we'dwant to get some of theairflow into the storageroom from. Use theexisting ductwork anduse some DOAS air?Are these slotdiffusers for theLobby space? I'mgoing to assume thatwe need a ducted unitfor this space to gowhere the existingVAV is.3088Have restroom supply tap off of Lobby FCU. Loads will bevery similar so there shouldn't be any need to have aseparate FCU (nor can I tell if there is any supply in therestroom already). I upsized the FCU from 2 to 2.5 Tons toaccomodate.482x linesetup to 2ndfloorNominal size of 48 tomeet sensible loadrequirements. 36 MBHnominal doesn't quitemeet it.December 5, 2023 H - 47 M4.2SECOND FLOOR, SENIOR CENTERREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDESENIOR CENTER SECOND FLOORM4.21SHEET NOTES1NEW MAU DUCT DOWN TO KITCHEN, COORDINATE LOCATION INSECOND FLOOR STORAGE CLOSET WITH OWNERN11Serve via ducted unit in themechanical room? Corridorand restrooms to share a unitlike downstairs.182412618I don't see any airdistribution accountedfor in the billiardsroom. I have a 3x3ceiling cassetteselected, but a ductedunit might be thebetter option. It'sunknown at this time.18Piping up from 1stFloor BCFrom BC in attic December 5, 2023 H - 48 ///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// /// ////////////////////////////////////////////////////////// / ///////////////////////////////////////////////////////////////////////////////////////////////////////////////// ////// / / / /////////////////////////////////////////////////////////////////////////////////////////////////////// / / /////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////M4.3DMECH ROOM DEMO, SENIOR CENTERREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDESENIOR CENTER MECH ROOM - LOWERM4.3D1SHEET NOTES1DEMOLISH AND REMOVE EXISTING INDOOR AIR HANDLING UNITS,MIXING BOXES, ELECTRIC RESISTANCE HEATERS AND SUPPLY AIRDUCTWORK AS SHOWN, PRESERVE EXISTING SUPPLY AIR SMOKEDETECTORS AND BYPASS BOXESN2DEMOLISH AND REMOVE EXISTING BUILDING RELEIF FANS ANDRELIEF DUCT, CAP DUCT AT LIMIT OF DEMOLITION34PRESERVE AND RE-USE EXISTING RETURN AIR FANS, RF-1 & RF-2SENIOR CENTER MECH ROOM - UPPERM4.3D1NDEMOLISH AND REMOVE EXISTING RETURN AIR DUCTWORK ANDALLOW RETURN AIR TO DISCHARGE DIRECTION INTO THEMECHANICAL ROOM, PROVIDE RA GRILLES AT LIMITS OF DEMOLITION1111233333445PRESERVE AND RE-USE EXISTING BYPASS BOXES, ALLOWDISCHARGE DIRECTLY INTO MECHANICAL ROOM5556DEMOLISH AND REMOVE EXISTING REFRIGERANT LINE SETS67PRESERVE AND RE-USE EXISTING SMOKE DETECTORS (TYP 4)7777IN1-1IN1-2IN4-1IN4-2IN4-3- wait until spring- demo outdoor units & refer lines, keep indoor units- demo storage room wall(s) marked with red "X"- operate building on existing units, electric heat, natural ventilation- install new outdoor units and refer lines- install new branch boxes- install new indoor units in existing storage area- install new ERVs in existing storage area- demo outside air and return duct to make room for new supply duct,double blue line- install new supply air duct, as close as possible to POC- shutdown old indoor units, reconnect new supply duct, changeover tounew units, one unit at a time- demo old indoor units and remainder of unused duct, use South louversfor trash chute- install ERV duct, close up South louver trash chute- demo building relief fans and duct, install MAU & duct to kitchen (thiscould be done first, or last, doesn't matter)BC-1, 2 & 3: stackedSupply airOutside airExhaust air4,000 CFM,24" round3,000 CFM,22" round1000 CFM,18"x12"1000 CFM,16"x14"4,500CFM, 26"round3 ERVs, stacked;serving zones 2 & 33 MAUs, stacked;serving kitchen(moved over here toallow room for EAducting to louvers)Return Air3 ERVs, stacked;serving zones 1 & 4connect return air toexisting return airheaderconnect [fresh] supplyair to existing supplyductwork[fresh] supply air tointake air plenum forIN 1-* and IN 4-*December 5, 2023 H - 49 UP1M4.3ERV2ERV3ERV4ERV5ERV1IN1-1IN1-2IN2-1IN2-2IN2-3IN3-1IN3-2IN3-3IN4-1IN4-2BC2IN3-4IN4-3BC1MAU1BC3MAU1MAU2MAU3M4.3MECH ROOM, SENIOR CENTERREVISION DESCRIPTIONAPP'D.REV.DATE33711 HIGHWAY 95LEWISTON, ID 83501208-792-19042333 158TH COURT NEBELLEVUE, WA 98008425-643-4310RTS7-10-23CITY OF PORT ANGELESPORT ANGELES SENIOR CENTER37-10-23IGA SET125-9-23 MECHANICAL PROGRESS5-31-23IGA SET - FOR REVIEWDRAWNDATEAPP'DDESIGN87654321BACDESENIOR CENTER MECH ROOM - ENLARGEDM4.32SHEET NOTES1EXISTING PANEL M1, REMOVE EXISTING 20A 3-PH BREAKER FOR AH-1AT CIRCUITS 7, 9 & 11, EXISTING 20A 3-PH BREAKER FOR AH-4 ATCIRCUIT 19, 21 & 23 AND EXISTING 20A 1-PH BREAKERS AT CIRCUITS22, 24, 26, 28 & 30. PROVIDE AND INSTALL NEW WIRE, COUNDUIT ANDBREAKERS FOR NEW INDOOR UNITS AND ERVS ACCORDING TOEQUIPMENT MOCPN1MAKEUP AIR SECTIONM4.31N2CONNECT NEW INDOOR UNITS TO EXISTING SUPPLY AIR DUCTS,PRESERVE AND RE-USE BYPASS BOXES AND SUPPLY AIR SMOKEDETECTORS22223CONNECT NEW ERVS TO EXISTING OUTSIDE AIR INTAKE DUCT,ROUTE NEW EXHAUST DUCT TO EXISTING BUILDING RELIEFLOUVERS34INTERLOCK NEW MAKEUP AIR UNITS TO EXISTING EXHAUST FANSEF-2 AND EF-34December 5, 2023 H - 50 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG -RE1DPH 6\VWHP5HIHUHQFH 'DWH *(1(5$/)($785(6 0XOWLSRVLWLRQGHVLJQLVVXLWDEOHIRUDQ\DSSOLFDWLRQUHTXLUHVQRDGGLWLRQDO NLWVHYHQIRUGRZQÀRZFRQ¿JXUDWLRQ +LJKO\HI¿FLHQW'&PRWRUDQGDIRUZDUGFXUYHGEORZHUHQVXUHVTXLHW FRQVLVWHQWIDQRSHUDWLRQ 6HOHFWDEOHH[WHUQDOVWDWLFSUHVVXUH DQGLQ:*ZLWKIDQ VSHHGVDWHDFKVWDWLFVHWWLQJ LQFK5¿EHUJODVVIUHHLQVXODWLRQUHGXFHVFRQGHQVDWLRQDQGERRVWV HI¿FLHQF\ 3RVLWLYHSUHVVXUHFDELQHWZLWKDLUOHDNDJHRIOHVVWKDQDW,Q:* 7HVWHGSHU$6+5$(6WDQGDUG 8QLTXHEORZWKURXJKGHVLJQDOORZVVLPSOHFRLOFOHDQLQJZKHQWKHEORZHULV UHPRYHG 2SWLRQDOHOHFWULFKHDWNLWIRUDGGLWLRQDOKHDWFDSDFLW\ 2SWLRQDOKXPLGL¿HUFRQWURODQG(59FRQWURO 6SHFL¿FDWLRQV 6\VWHP 8QLW7\SH 739)<3$0$ &RROLQJFDSDFLW\ 1RPLQDO 1 %78+ +HDWLQJFDSDFLW\ 1RPLQDO 1 %78+ 3RZHUVRXUFH 9ROWDJH3KDVH+HUW]9SKDVH+] 0&$$ 0D[LPXP2YHUFXUUHQW3URWHFWLRQ 02&3 $ ([WHUQDO¿QLVK +LJKJORVVSRO\HVWHUSRZGHUFRDWHG ([WHUQDO'LPHQVLRQV ,Q>PP@ [[ >[[@ 1HWZHLJKW /EV>NJ@ >@ +HDWH[FKDQJHU &URVV¿Q $OXPLQXP¿QDQGFRSSHUWXEH )DQ 7\SH[TXDQWLW\6LURFFRIDQ[ ([WHUQDO6WDWLFSUHVVXUH LQ:* $LUÀRZUDWH &)0 ±± 0RWRUW\SH '&PRWRU 6RXQGSUHVVXUHOHYHO 0HDVXUHGLQDQHFKRLFURRP G% $ ±± $LU¿OWHU 3RO\SURS\OHQH+RQH\FRPE 5HIULJHUDQW 7\SH 5$ 'LDPHWHURIUHIULJHUDQWSLSH 2' /LTXLG +LJK3UHVVXUH ,Q>PP@ > @%UD]HG *DV /RZ3UHVVXUH ,Q>PP@ >@%UD]HG 'LDPHWHURIGUDLQSLSH ,Q>PP@ )37> @ 127(6 1&RROLQJ+HDWLQJFDSDFLW\LQGLFDWHGDWWKHPD[LPXPYDOXHDWRSHUDWLRQXQGHUWKHIROORZLQJFRQGLWLRQV &RROLQJ_,QGRRU ) & '%) & :% 2XWGRRU ) & '% +HDWLQJ_,QGRRU ) & '% 2XWGRRU) & '%) & :% TPVFYP054AM141A December 5, 2023 H - 51 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG INDOOR UNIT ACCESSORIES: TPVFYP054AM141A &RQWURO,QWHUIDFH %$&QHW®DQG0RGEXV®,QWHUIDFH 3$&8.35&&1 &15HOD\.LW &15(/$<.,7&0 ,7([WHQGHU 3$&:+6,(( NXPRVWDWLRQ®IRUNXPRFORXG® 7$&:+6+&( 7KHUPRVWDW,QWHUIDFH 3$&86&1 7KHUPRVWDW,QWHUIDFH 3$&86&1 5HPRWH6HQVRU )OXVK0RXQW5HPRWH7HPSHUDWXUH6HQVRU 3$&866(1)0 )OXVK0RXQW7HPSHUDWXUH6HQVRU 3$&866(1)0 5HPRWH7HPSHUDWXUH6HQVRU 3$&6(76( 7HUPLQDO6LJQDO$GDSWHU 7HUPLQDO6LJQDO$GDSWHU 3$&,7$'( 7HUPLQDO6LJQDO$GDSWHU 3$&,7$'( :LUHG5HPRWH&RQWUROOHU 'HOX[H:LUHG0$5HPRWH&RQWUROOHU† 7$50$$8 6LPSOH0$5HPRWH&RQWUROOHU† 7$&<7&5$8- 6PDUW0(5HPRWH&RQWUROOHU%DFNOLWWRXFKVFUHHQ 7$580('8. 7RXFK0$&RQWUROOHU† 7$5&70$86% :LUHOHVV5HPRWH&RQWUROOHU NXPRWRXFK™5HG/,1.™:LUHOHVV&RQWUROOHU 0+. :LUHOHVV0$5HFHLYHU 3$5650$( :LUHOHVV0$5HPRWH&RQWUROOHU 7$5)/0$( &RQGHQVDWH %OXH'LDPRQG $GYDQFHG 0LQL&RQGHQVDWH3XPSZ5HVHUYRLU 6HQVRU 9 >UHFRPPHQGHG@ ; %OXH'LDPRQG 0HJD%OXH$GYDQFHG &RQGHQVDWH3XPSZ5HVHUYRLU 6HQVRU ; %OXH'LDPRQG0XOWL7DQN²FROOHFWLRQWDQNIRUXVHZLWKPXOWLSOHSXPSV & %OXH'LDPRQG6HQVRU([WHQVLRQ&DEOH²)W & 5HIFR&RQGHQVDWH3XPS 9$& XSWR%78+ &20%, 6DXHUPDQQ&RQGHQVDWH3XPS 6, (OHFWULF+HDW/RFNRXW (OHFWULF+HDW/RFNRXW (7&0,7 (OHFWULF.LW+HDWV N:(OHFWULF+HDWHU (+03$/% N:(OHFWULF+HDWHU (+03$6/% N:(OHFWULF+HDWHU (+03$6/% Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ December 5, 2023 H - 52 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG )250739)<3$0$Units: mm (in.)TPVFYP012AM141ATPVFYP008AM141ATPVFYP018AM141ATPVFYP024AM141ATPVFYP030AM141ATPVFYP036AM141ATPVFYP048AM141ATPVFYP054AM141ATPVFYP012AM141ATPVFYP008AM141ATPVFYP018AM141ATPVFYP024AM141ATPVFYP030AM141ATPVFYP036AM141ATPVFYP048AM141ATPVFYP054AM141AINDOOR UNIT DIMENSIONS: TPVFYP054AM141A December 5, 2023 H - 53 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG -RE1DPH 6\VWHP5HIHUHQFH 'DWH UNIT OPTION 6WDQGDUG0RGHO 385<37618$ 6HDFRDVW %6 0RGHO 385<37618$%6 ACCESSORIES 7ZLQQLQJ.LW 5HTXLUHG &0<51&%. %&&RQWUROOHU 5HTXLUHG IRUGHWDLOVVHH%&&RQWUROOHU6XEPLWWDOV -RLQW.LW IRUGHWDLOVVHH3LSH$FFHVVRULHV6XEPLWWDO 3DQHO+HDWHU.LW IRUGHWDLOVVHH3DQHO+HDWHU.LW6XEPLWWDO 6QRZ+DLO*XDUGV.LW IRUGHWDLOVVHH6QRZ+DLO*XDUGV.LW6XEPLWWDO 208/230V OUTDOOR VRF HEAT RECOVERY SYSTEM 6SHFL¿FDWLRQV 6\VWHP 8QLW7\SH PURY-P216TSNU-A(-BS) &RROLQJ&DSDFLW\ 1RPLQDO %78+ +HDWLQJ&DSDFLW\ 1RPLQDO %78+ 1HW:HLJKW /EV>NJ@ >@ 5HIULJHUDQW3LSLQJ'LDPHWHU /LTXLG +LJK3UHVVXUH ,Q>PP@ >@%UD]HG 3LSH6L]H'HSHQGHQWRQ3LSLQJ/HQJWK *DV /RZ3UHVVXUH ,Q>PP@ >@%UD]HG 0D[7RWDO5HIULJHUDQW/LQH/HQJWK )W 0D[5HIULJHUDQW/LQH/HQJWK %HWZHHQ2'8 ,'8 )W 0D[&RQWURO:LULQJ/HQJWK )W ,QGRRU8QLW&RQQHFWDEOH 7RWDO&DSDFLW\aRIRXWGRRUXQLWFDSDFLW\ 0RGHO4XDQWLW\3a3 a 6RXQG3UHVVXUH/HYHOV G% $ 6RXQG3RZHU/HYHOV G% $ &RPSUHVVRU2SHUDWLQJ5DQJH WR $+5,5DWLQJV 'XFWHG1RQGXFWHG ((5 ,((5 &23 6&+( 6SHFL¿FDWLRQV 0RGXOH0RGXOH 8QLW7\SH PURY-P120TNU-A(-BS)PURY-P96TNU-A(-BS) &RROLQJ&DSDFLW\ 1RPLQDO %78+ +HDWLQJ&DSDFLW\ 1RPLQDO %78+ *XDUDQWHHG2SHUDWLQJ5DQJH&RROLQJ)>&@ a>a@ a>a@ *XDUDQWHHG2SHUDWLQJ5DQJH +HDWLQJ )>&@ a>a@ a>a@ ([WHQGHG2SHUDWLQJ5DQJH +HDWLQJ )>&@ a>a@ a>a@ ([WHUQDO'LPHQVLRQV +[:[' ,Q>PP@ [[ >[[@ [[ >[[@ 1HW:HLJKW /EV>NJ@ >@ >@ ([WHUQDO)LQLVK 3UHFRDWHGJDOYDQL]HGVWHHOVKHHW SRZGHUFRDWLQJIRU%6 W\SH >0816(//<@ 3UHFRDWHGJDOYDQL]HGVWHHOVKHHW SRZGHUFRDWLQJIRU%6 W\SH >0816(//<@ (OHFWULFDO3RZHU5HTXLUHPHQWV 9ROWDJH3KDVH+HUW]3RZHU 7ROHUDQFH 9SKDVH+]9SKDVH+] 0LQLPXP&LUFXLW$PSDFLW\$ 0D[LPXP2YHUFXUUHQW3URWHFWLRQ $ 5HFRPPHQGHG)XVH6L]H $ 5HFRPPHQGHG0LQLPXP:LUH6L]H $:*>PP@ >@ >@ 6&&5 N$ )$1 7\SH[4XDQWLW\3URSHOOHUIDQ[3URSHOOHUIDQ[ $LUÀRZ5DWH &)0 ([WHUQDO6WDWLF3UHVVXUH ,Q:* 6HOHFWDEOH ,Q:* IDFWRU\VHWWR,Q:* 6HOHFWDEOH ,Q:* IDFWRU\VHWWR,Q:* &RPSUHVVRU 7\SH[4XDQWLW\,QYHUWHUVFUROOKHUPHWLFFRPSUHVVRU[,QYHUWHUVFUROOKHUPHWLFFRPSUHVVRU[ 5HIULJHUDQW 7\SH[2ULJLQDO&KDUJH 5$[OEVR]>NJ@ 5$[OEVR]>NJ@ 3URWHFWLRQ'HYLFHV +LJK3UHVVXUH3URWHFWLRQ +LJKSUHVVXUHVHQVRU+LJKSUHVVXUHVZLWFKDW03D SVL +LJKSUHVVXUHVHQVRU+LJKSUHVVXUHVZLWFKDW03D SVL ,QYHUWHU&LUFXLW &RPS)DQ 2YHUKHDWSURWHFWLRQ2YHUFXUUHQWSURWHFWLRQ 2YHUKHDWSURWHFWLRQ2YHUFXUUHQWSURWHFWLRQ 127(6 1RPLQDOFRROLQJFRQGLWLRQV 7HVWFRQGLWLRQVDUHEDVHGRQ$+5, ,QGRRU )'%):% &'% &:% 2XWGRRU )'% &'% 1RPLQDOKHDWLQJFRQGLWLRQV 7HVWFRQGLWLRQVDUHEDVHGRQ$+5, ,QGRRU )'% &'% 2XWGRRU )'%):% &'%&:% +DUVKZHDWKHUHQYLURQPHQWVPD\GHPDQGSHUIRUPDQFHHQKDQFLQJHTXLSPHQW$VN\RXU0LWVXELVKL (OHFWULFUHSUHVHQWDWLYHIRUPRUHGHWDLOVDERXW\RXUUHJLRQ )RUGHWDLOVRQH[WHQGHGFRROLQJRSHUDWLRQUDQJHGRZQWR)'%VHH/RZ$PELHQW.LW6XEPLWWDO :KHQDSSO\LQJSURGXFWEHORZ)FRQVXOW\RXUGHVLJQHQJLQHHUIRUFROGFOLPDWHDSSOLFDWLRQEHVW SUDFWLFHVLQFOXGLQJWKHXVHRIDEDFNXSVRXUFHIRUKHDWLQJ 8QLWZLOOFRQWLQXHWRRSHUDWHLQH[WHQGHGRSHUDWLQJUDQJHEXWFDSDFLW\LVQRWJXDUDQWHHG (DFKLQGLYLGXDOPRGXOHUHTXLUHVDVHSDUDWHHOHFWULFDOFRQQHFWLRQ5HIHUWRHOHFWULFDOGDWDIRUHDFKLQGLYLGXDOPRGXOH 18-TON PURY-P216TSNU-A(-BS) Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ December 5, 2023 H - 54 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG OUTDOOR UNIT: PURY-P216TSNU-A(-BS) – DIMENSIONS 127(6 6($&2$673527(&7,21 $QWLFRUURVLRQ3URWHFWLRQ $FRDWLQJWUHDWPHQWLVDSSOLHGWRFRQGHQVHUFRLOIRUSURWHFWLRQIURPDLUFRQWDPLQDQWV 6WDQGDUG 6DOW6SUD\7HVW0HWKRGQRXQXVXDOUXVWGHYHORSPHQWWRKRXUV 6HD&RDVW %6 6DOW6SUD\7HVW0HWKRG -5$ QRXQXVXDOUXVWGHYHORSPHQWWR KRXUV PURY-P192,216,240,264,288TSNU-A(-BS)Unit: mm(in)Outdoor unit 2 Front viewOutdoor unit 1 IntakeairDischarge air cbTo BC controlleraTwinning pipe(High pressure)eTo BC controller<optional parts>Twinning pipe(Low pressure)<optional parts>dfLeft viewIntakeairIntakeairIntakeairNote 1. Connect the pipes as shown in the figure above. Refer to the table above for the pipe size.2. Twinning pipes should not be tilted more than 15 degrees from the horizontal plane.Be sure to see the Installation Manual for details of Twinning pipe installation.3. The pipe section before the Twinning pipe (section ″a″and ″b″in the figure) must have at least 500mm(19-11/16) of straight section(*including the straight pipe that is supplied with the Twinning pipe).4. Only use the Twinning pipe by Mitsubishi (optional parts). Twinning pipe connection sizeø28.58(1-1/8)ø22.2(7/8)(ø28.58(1-1/8)) *CMY-R300NCBKPURY-P192TSNU-A(-BS)PURY-P96TNU-A(-BS)PURY-P96TNU-A(-BS)PURY-P216TSNU-A(-BS)PURY-P96TNU-A(-BS)PURY-P240TSNU-A(-BS) PURY-P264TSNU-A(-BS) PURY-P288TSNU-A(-BS)ø34.93(1-3/8)Low pressured or fHigh pressurec or eUnit modelTwinning pipe~Outdoor unitP96ø19.05(3/4)P120P144ø22.2(7/8)ø28.58(1-1/8)ø28.58(1-1/8)abHigh pressureLow pressureComponent unit nameOutdoor unit 1Package unit nameOutdoor Twinning Kit(optional parts)BC controller ~Twinning pipeOutdoor unit 2PURY-P120TNU-A(-BS) PURY-P120TNU-A(-BS)PURY-P120TNU-A(-BS) PURY-P120TNU-A(-BS)PURY-P144TNU-A(-BS) PURY-P144TNU-A(-BS)PURY-P144TNU-A(-BS))8/1-1(85.82ø)8/7(2.22øø19.05(3/4)ø22.2(7/8)* When the piping length is 65m(213ft) or longer,use the ø28.58(1-1/8) pipe for the part that exceeds 65m(213ft).CMY-R200NCBK740(29-3/16)1240(48-7/8)1818(71-5/8)1240(48-7/8)30(1-3/16)December 5, 2023 H - 55 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG 127(6 6($&2$673527(&7,21 $QWLFRUURVLRQ3URWHFWLRQ $FRDWLQJWUHDWPHQWLVDSSOLHGWRFRQGHQVHUFRLOIRUSURWHFWLRQIURPDLUFRQWDPLQDQWV 6WDQGDUG 6DOW6SUD\7HVW0HWKRGQRXQXVXDOUXVWGHYHORSPHQWWRKRXUV 6HD&RDVW %6 6DOW6SUD\7HVW0HWKRG -5$ QRXQXVXDOUXVWGHYHORSPHQWWR KRXUV PURY-P96,120,144TNU-A(-BS)Unit: mm(in)712435678NO.2568(Mounting pitch)Bottom view(Mounting pitch)2×2-14(9/16)×20(13/16) Oval hole1Control box34ServicepanelIntakeairIntakeairDischarge airIntakeairIntakeair2×6-ø4.6(3/16) Hole(Make hole at the plastic fan guardfor snow hood attachment)<Snow hood attachment hole>Top viewFront viewLeft side viewRear viewRefrigerant service valve<High pressure>Refrigerant service valve<Low pressure>Connecting pipe specifications*1 Connect the refrigerant pipe to the service valveaccording to the Installation Manual. ModelDiameterRefrigerant pipe Service valve P120ø28.58(1-1/8)ø19.05(3/4) Brazed *1 ø28.58(1-1/8)P96High pressureLow pressureø28.58(1-1/8) Brazed ø22.2(7/8) Brazed *1 P144High pressureLow pressureø22.2(7/8) Brazed *1 For transmission cablesFor wiresFor pipes snoitacificepSegasUFront through holeBottom through holeFront through holeFront through holeBottom through holeBottom through holeFront through hole148(5-7/8) × 84(3-5/16) Knockout hole ø62.7(2-1/2) or ø34.5(1-3/8) Knockout hole ø43.7(1-3/4) or ø22.2(7/8) Knockout hole ø65(2-9/16) Knockout hole ø52(2-1/16) Knockout hole ø34(1-3/8) Knockout hole 150(5-15/16) × 94(3-3/4) Knockout hole ø34(1-3/8) Knockout hole Bottom through hole740(29-3/16)70(2-13/16)150(5-15/16)85(3-3/8)85(3-3/8)130(5-1/8)15018(3/4)1204(47-7/16)181240(48-7/8)110(4-3/8)(740)(29-3/16)185(7-5/16)29.5681(678~684)29.59479181160(6-5/16)243(9-5/8)150128(5-1/16)125132(5-1/4)207(8-3/16)256(10-1/8)109129(5-1/8)84(3-5/16)90(3-9/16)54(2-3/16)135(5-3/8)20(13/16)54591(23-5/16)54(2-3/16)20(13/16)148(5-7/8)152(6)216(8-9/16)166144(5-11/16)3031515(59-11/16)1818(71-5/8)90(3-9/16)1060(41-3/4)90(3-9/16)172(6-13/16)(3-3/4)(3-1/8)(5-15/16)(6-9/16)(7-3/16)(26-13/16)(26-3/4~26-15/16)(1-3/16)(11-15/16)(4-5/16)(4-15/16)(2-3/16)(3/4)(5-15/16)(1-3/16)Note 1. At brazing of pipes, wrap the refrigerant service valve with wet cloth and keep the temperature of refrigerant service valve under 120°C(248°F).MODULE 1: PURY-P120TNU-A(-BS) – DIMENSIONS December 5, 2023 H - 56 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG 127(6 6($&2$673527(&7,21 $QWLFRUURVLRQ3URWHFWLRQ $FRDWLQJWUHDWPHQWLVDSSOLHGWRFRQGHQVHUFRLOIRUSURWHFWLRQIURPDLUFRQWDPLQDQWV 6WDQGDUG 6DOW6SUD\7HVW0HWKRGQRXQXVXDOUXVWGHYHORSPHQWWRKRXUV 6HD&RDVW %6 6DOW6SUD\7HVW0HWKRG -5$ QRXQXVXDOUXVWGHYHORSPHQWWR KRXUV PURY-P96,120,144TNU-A(-BS)Unit: mm(in)712435678NO.2568(Mounting pitch)Bottom view(Mounting pitch)2×2-14(9/16)×20(13/16) Oval hole1Control box34ServicepanelIntakeairIntakeairDischarge airIntakeairIntakeair2×6-ø4.6(3/16) Hole(Make hole at the plastic fan guardfor snow hood attachment)<Snow hood attachment hole>Top viewFront viewLeft side viewRear viewRefrigerant service valve<High pressure>Refrigerant service valve<Low pressure>Connecting pipe specifications*1 Connect the refrigerant pipe to the service valveaccording to the Installation Manual. ModelDiameterRefrigerant pipe Service valve P120ø28.58(1-1/8)ø19.05(3/4) Brazed *1 ø28.58(1-1/8)P96High pressureLow pressureø28.58(1-1/8) Brazed ø22.2(7/8) Brazed *1 P144High pressureLow pressureø22.2(7/8) Brazed *1 For transmission cablesFor wiresFor pipes snoitacificepSegasUFront through holeBottom through holeFront through holeFront through holeBottom through holeBottom through holeFront through hole148(5-7/8) × 84(3-5/16) Knockout hole ø62.7(2-1/2) or ø34.5(1-3/8) Knockout hole ø43.7(1-3/4) or ø22.2(7/8) Knockout hole ø65(2-9/16) Knockout hole ø52(2-1/16) Knockout hole ø34(1-3/8) Knockout hole 150(5-15/16) × 94(3-3/4) Knockout hole ø34(1-3/8) Knockout hole Bottom through hole740(29-3/16)70(2-13/16)150(5-15/16)85(3-3/8)85(3-3/8)130(5-1/8)15018(3/4)1204(47-7/16)181240(48-7/8)110(4-3/8)(740)(29-3/16)185(7-5/16)29.5681(678~684)29.59479181160(6-5/16)243(9-5/8)150128(5-1/16)125132(5-1/4)207(8-3/16)256(10-1/8)109129(5-1/8)84(3-5/16)90(3-9/16)54(2-3/16)135(5-3/8)20(13/16)54591(23-5/16)54(2-3/16)20(13/16)148(5-7/8)152(6)216(8-9/16)166144(5-11/16)3031515(59-11/16)1818(71-5/8)90(3-9/16)1060(41-3/4)90(3-9/16)172(6-13/16)(3-3/4)(3-1/8)(5-15/16)(6-9/16)(7-3/16)(26-13/16)(26-3/4~26-15/16)(1-3/16)(11-15/16)(4-5/16)(4-15/16)(2-3/16)(3/4)(5-15/16)(1-3/16)Note 1. At brazing of pipes, wrap the refrigerant service valve with wet cloth and keep the temperature of refrigerant service valve under 120°C(248°F).MODULE 2: PURY-P96TNU-A(-BS) – DIMENSIONS December 5, 2023 H - 57 )250385<37618$Variable Refrigerant Flow (VRF) Multi-Split AC and HP AHRI Standard 1230 6DWHOOLWH%RXOHYDUG6XZDQHH*$ 7ROO)UHH ZZZPHKYDFFRP Unit: mm (in.)CMY-R200NCBK <Deformed pipe(Accessory)> ø25.4(ø1) (Outside diameter) Twinning pipe ø28.58(ø1-3/16) ø28.58(ø1-3/16) (Outside diameter) Local brazing ø22.2(ø7/8) ø22.2(ø7/8) Pipe cover (Dot-dashed ø25.4(ø1) (Outside diameter) Note 2 High-pressure twinning pipe Low-pressure twinning pipe ø19.05(ø3/4) ø19.05(ø3/4) ø22.2(ø7/8) ø28.58(ø1-3/16)ø22.2(ø7/8) (Outside diameter) ø34.93(ø1-7/16)ø28.58(ø1-3/16) (Outside diameter) (2 pcs.) (2-1/2) (3-3/16)(1-7/16)part) (342)(13-1/2) 588(23-3/16) 505(19-29/32)160(6-5/16)80 3562 100(3-15/16) Twinning pipe ±15°Note: 1. Refer to the figure below for the installation position of the twinning pipe. 2. Use the attached pipe to braze the port-opening of the twinning pipe. 3. Pipe diameter is indicated by inside diameter. Slope of the twinning pipes are at an angle within ±15° to the horizontal plane. The angle of the twinning pipe is within ±15° against the horizontal plane. 2. Use the attached pipe to braze the port-opening of the twinning pipe. 3. Pipe diameter is indicated by inside diameter. 4. Only use the Twinning pipe by Mitsubishi (optional parts) . Note 1. Reference the attitude angle of the twinning pipe below the fig. Twinning pipe ±15°TWINNING KIT: CMY-R200NCBK – DIMENSIONS 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHGDecember 5, 2023 H - 58 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG -RE1DPH 6\VWHP5HIHUHQFH 'DWH UNIT OPTION 6WDQGDUG0RGHO 385<37618$ 6HDFRDVW %6 0RGHO 385<37618$%6 ACCESSORIES 7ZLQQLQJ.LW 5HTXLUHG &0<51&%. %&&RQWUROOHU 5HTXLUHG IRUGHWDLOVVHH%&&RQWUROOHU6XEPLWWDOV -RLQW.LW IRUGHWDLOVVHH3LSH$FFHVVRULHV6XEPLWWDO 3DQHO+HDWHU.LW IRUGHWDLOVVHH3DQHO+HDWHU.LW6XEPLWWDO 6QRZ+DLO*XDUGV.LW IRUGHWDLOVVHH6QRZ+DLO*XDUGV.LW6XEPLWWDO 208/230V OUTDOOR VRF HEAT RECOVERY SYSTEM 6SHFL¿FDWLRQV 6\VWHP 8QLW7\SH PURY-P288TSNU-A(-BS) &RROLQJ&DSDFLW\ 1RPLQDO %78+ +HDWLQJ&DSDFLW\ 1RPLQDO %78+ 1HW:HLJKW /EV>NJ@ >@ 5HIULJHUDQW3LSLQJ'LDPHWHU /LTXLG +LJK3UHVVXUH ,Q>PP@ >@%UD]HG *DV /RZ3UHVVXUH ,Q>PP@ > @%UD]HG 0D[7RWDO5HIULJHUDQW/LQH/HQJWK )W 0D[5HIULJHUDQW/LQH/HQJWK %HWZHHQ2'8 ,'8 )W 0D[&RQWURO:LULQJ/HQJWK )W ,QGRRU8QLW&RQQHFWDEOH 7RWDO&DSDFLW\aRIRXWGRRUXQLWFDSDFLW\ 0RGHO4XDQWLW\3a3 a 6RXQG3UHVVXUH/HYHOV G% $ 6RXQG3RZHU/HYHOV G% $ &RPSUHVVRU2SHUDWLQJ5DQJH WR $+5,5DWLQJV 'XFWHG1RQGXFWHG ((5 ,((5 &23 6&+( 6SHFL¿FDWLRQV 0RGXOH0RGXOH 8QLW7\SH 385<3718$ %6 385<3718$ %6 &RROLQJ&DSDFLW\ 1RPLQDO %78+ +HDWLQJ&DSDFLW\ 1RPLQDO %78+ *XDUDQWHHG2SHUDWLQJ5DQJH1 &RROLQJ)>&@ a>a@ a>a@ *XDUDQWHHG2SHUDWLQJ5DQJH +HDWLQJ )>&@ a>a@ a>a@ ([WHQGHG2SHUDWLQJ5DQJH +HDWLQJ )>&@ a>a@ a>a@ ([WHUQDO'LPHQVLRQV +[:[' ,Q>PP@ [[ >[[@ [[ >[[@ 1HW:HLJKW /EV>NJ@ > @ > @ ([WHUQDO)LQLVK 3UHFRDWHGJDOYDQL]HGVWHHOVKHHW SRZGHUFRDWLQJIRU%6 W\SH >0816(//<@ 3UHFRDWHGJDOYDQL]HGVWHHOVKHHW SRZGHUFRDWLQJIRU%6 W\SH >0816(//<@ (OHFWULFDO3RZHU5HTXLUHPHQWV 9ROWDJH3KDVH+HUW]3RZHU 7ROHUDQFH 9SKDVH+]9SKDVH+] 0LQLPXP&LUFXLW$PSDFLW\$ 0D[LPXP2YHUFXUUHQW3URWHFWLRQ $ 5HFRPPHQGHG)XVH6L]H $ 5HFRPPHQGHG0LQLPXP:LUH6L]H $:*>PP@ >@ >@ 6&&5 N$ )$1 7\SH[4XDQWLW\3URSHOOHUIDQ[3URSHOOHUIDQ[ $LUÀRZ5DWH &)0 ([WHUQDO6WDWLF3UHVVXUH ,Q:* 6HOHFWDEOH ,Q:* IDFWRU\VHWWR,Q:* 6HOHFWDEOH ,Q:* IDFWRU\VHWWR,Q:* &RPSUHVVRU 7\SH[4XDQWLW\,QYHUWHUVFUROOKHUPHWLFFRPSUHVVRU[,QYHUWHUVFUROOKHUPHWLFFRPSUHVVRU[ 5HIULJHUDQW 7\SH[2ULJLQDO&KDUJH 5$[OEVR]>NJ@ 5$[OEVR]>NJ@ 3URWHFWLRQ'HYLFHV +LJK3UHVVXUH3URWHFWLRQ +LJKSUHVVXUHVHQVRU+LJKSUHVVXUHVZLWFKDW03D SVL +LJKSUHVVXUHVHQVRU+LJKSUHVVXUHVZLWFKDW03D SVL ,QYHUWHU&LUFXLW &RPS)DQ 2YHUKHDWSURWHFWLRQ2YHUFXUUHQWSURWHFWLRQ 2YHUKHDWSURWHFWLRQ2YHUFXUUHQWSURWHFWLRQ 127(6 1RPLQDOFRROLQJFRQGLWLRQV 7HVWFRQGLWLRQVDUHEDVHGRQ$+5, ,QGRRU )'%):% &'% &:% 2XWGRRU )'% &'% 1RPLQDOKHDWLQJFRQGLWLRQV 7HVWFRQGLWLRQVDUHEDVHGRQ$+5, ,QGRRU )'% &'% 2XWGRRU )'%):% &'%&:% +DUVKZHDWKHUHQYLURQPHQWVPD\GHPDQGSHUIRUPDQFHHQKDQFLQJHTXLSPHQW$VN\RXU0LWVXELVKL (OHFWULFUHSUHVHQWDWLYHIRUPRUHGHWDLOVDERXW\RXUUHJLRQ )RUGHWDLOVRQH[WHQGHGFRROLQJRSHUDWLRQUDQJHGRZQWR)'%VHH/RZ$PELHQW.LW6XEPLWWDO :KHQDSSO\LQJSURGXFWEHORZ)FRQVXOW\RXUGHVLJQHQJLQHHUIRUFROGFOLPDWHDSSOLFDWLRQEHVW SUDFWLFHVLQFOXGLQJWKHXVHRIDEDFNXSVRXUFHIRUKHDWLQJ 8QLWZLOOFRQWLQXHWRRSHUDWHLQH[WHQGHGRSHUDWLQJUDQJHEXWFDSDFLW\LVQRWJXDUDQWHHG (DFKLQGLYLGXDOPRGXOHUHTXLUHVDVHSDUDWHHOHFWULFDOFRQQHFWLRQ5HIHUWRHOHFWULFDOGDWDIRUHDFKLQGLYLGXDOPRGXOH 24-TON PURY-P288TSNU-A(-BS) Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ December 5, 2023 H - 59 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG OUTDOOR UNIT: PURY-P288TSNU-A(-BS) – DIMENSIONS 127(6 6($&2$673527(&7,21 $QWLFRUURVLRQ3URWHFWLRQ $FRDWLQJWUHDWPHQWLVDSSOLHGWRFRQGHQVHUFRLOIRUSURWHFWLRQIURPDLUFRQWDPLQDQWV 6WDQGDUG 6DOW6SUD\7HVW0HWKRGQRXQXVXDOUXVWGHYHORSPHQWWRKRXUV 6HD&RDVW %6 6DOW6SUD\7HVW0HWKRG -5$ QRXQXVXDOUXVWGHYHORSPHQWWR KRXUV PURY-P192,216,240,264,288TSNU-A(-BS)Unit: mm(in)Outdoor unit 2 Front viewOutdoor unit 1 IntakeairDischarge air cbTo BC controlleraTwinning pipe(High pressure)eTo BC controller<optional parts>Twinning pipe(Low pressure)<optional parts>dfLeft viewIntakeairIntakeairIntakeairNote 1. Connect the pipes as shown in the figure above. Refer to the table above for the pipe size.2. Twinning pipes should not be tilted more than 15 degrees from the horizontal plane.Be sure to see the Installation Manual for details of Twinning pipe installation.3. The pipe section before the Twinning pipe (section ″a″and ″b″in the figure) must have at least 500mm(19-11/16) of straight section(*including the straight pipe that is supplied with the Twinning pipe).4. Only use the Twinning pipe by Mitsubishi (optional parts). Twinning pipe connection sizeø28.58(1-1/8)ø22.2(7/8)(ø28.58(1-1/8)) *CMY-R300NCBKPURY-P192TSNU-A(-BS)PURY-P96TNU-A(-BS)PURY-P96TNU-A(-BS)PURY-P216TSNU-A(-BS)PURY-P96TNU-A(-BS)PURY-P240TSNU-A(-BS) PURY-P264TSNU-A(-BS) PURY-P288TSNU-A(-BS)ø34.93(1-3/8)Low pressured or fHigh pressurec or eUnit modelTwinning pipe~Outdoor unitP96ø19.05(3/4)P120P144ø22.2(7/8)ø28.58(1-1/8)ø28.58(1-1/8)abHigh pressureLow pressureComponent unit nameOutdoor unit 1Package unit nameOutdoor Twinning Kit(optional parts)BC controller ~Twinning pipeOutdoor unit 2PURY-P120TNU-A(-BS) PURY-P120TNU-A(-BS)PURY-P120TNU-A(-BS) PURY-P120TNU-A(-BS)PURY-P144TNU-A(-BS) PURY-P144TNU-A(-BS)PURY-P144TNU-A(-BS))8/1-1(85.82ø)8/7(2.22øø19.05(3/4)ø22.2(7/8)* When the piping length is 65m(213ft) or longer,use the ø28.58(1-1/8) pipe for the part that exceeds 65m(213ft).CMY-R200NCBK740(29-3/16)1240(48-7/8)1818(71-5/8)1240(48-7/8)30(1-3/16)December 5, 2023 H - 60 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG 127(6 6($&2$673527(&7,21 $QWLFRUURVLRQ3URWHFWLRQ $FRDWLQJWUHDWPHQWLVDSSOLHGWRFRQGHQVHUFRLOIRUSURWHFWLRQIURPDLUFRQWDPLQDQWV 6WDQGDUG 6DOW6SUD\7HVW0HWKRGQRXQXVXDOUXVWGHYHORSPHQWWRKRXUV 6HD&RDVW %6 6DOW6SUD\7HVW0HWKRG -5$ QRXQXVXDOUXVWGHYHORSPHQWWR KRXUV PURY-P96,120,144TNU-A(-BS)Unit: mm(in)712435678NO.2568(Mounting pitch)Bottom view(Mounting pitch)2×2-14(9/16)×20(13/16) Oval hole1Control box34ServicepanelIntakeairIntakeairDischarge airIntakeairIntakeair2×6-ø4.6(3/16) Hole(Make hole at the plastic fan guardfor snow hood attachment)<Snow hood attachment hole>Top viewFront viewLeft side viewRear viewRefrigerant service valve<High pressure>Refrigerant service valve<Low pressure>Connecting pipe specifications*1 Connect the refrigerant pipe to the service valveaccording to the Installation Manual. ModelDiameterRefrigerant pipe Service valve P120ø28.58(1-1/8)ø19.05(3/4) Brazed *1 ø28.58(1-1/8)P96High pressureLow pressureø28.58(1-1/8) Brazed ø22.2(7/8) Brazed *1 P144High pressureLow pressureø22.2(7/8) Brazed *1 For transmission cablesFor wiresFor pipes snoitacificepSegasUFront through holeBottom through holeFront through holeFront through holeBottom through holeBottom through holeFront through hole148(5-7/8) × 84(3-5/16) Knockout hole ø62.7(2-1/2) or ø34.5(1-3/8) Knockout hole ø43.7(1-3/4) or ø22.2(7/8) Knockout hole ø65(2-9/16) Knockout hole ø52(2-1/16) Knockout hole ø34(1-3/8) Knockout hole 150(5-15/16) × 94(3-3/4) Knockout hole ø34(1-3/8) Knockout hole Bottom through hole740(29-3/16)70(2-13/16)150(5-15/16)85(3-3/8)85(3-3/8)130(5-1/8)15018(3/4)1204(47-7/16)181240(48-7/8)110(4-3/8)(740)(29-3/16)185(7-5/16)29.5681(678~684)29.59479181160(6-5/16)243(9-5/8)150128(5-1/16)125132(5-1/4)207(8-3/16)256(10-1/8)109129(5-1/8)84(3-5/16)90(3-9/16)54(2-3/16)135(5-3/8)20(13/16)54591(23-5/16)54(2-3/16)20(13/16)148(5-7/8)152(6)216(8-9/16)166144(5-11/16)3031515(59-11/16)1818(71-5/8)90(3-9/16)1060(41-3/4)90(3-9/16)172(6-13/16)(3-3/4)(3-1/8)(5-15/16)(6-9/16)(7-3/16)(26-13/16)(26-3/4~26-15/16)(1-3/16)(11-15/16)(4-5/16)(4-15/16)(2-3/16)(3/4)(5-15/16)(1-3/16)Note 1. At brazing of pipes, wrap the refrigerant service valve with wet cloth and keep the temperature of refrigerant service valve under 120°C(248°F).MODULE 1: PURY-P144TNU-A(-BS) – DIMENSIONS December 5, 2023 H - 61 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG 127(6 6($&2$673527(&7,21 $QWLFRUURVLRQ3URWHFWLRQ $FRDWLQJWUHDWPHQWLVDSSOLHGWRFRQGHQVHUFRLOIRUSURWHFWLRQIURPDLUFRQWDPLQDQWV 6WDQGDUG 6DOW6SUD\7HVW0HWKRGQRXQXVXDOUXVWGHYHORSPHQWWRKRXUV 6HD&RDVW %6 6DOW6SUD\7HVW0HWKRG -5$ QRXQXVXDOUXVWGHYHORSPHQWWR KRXUV PURY-P96,120,144TNU-A(-BS)Unit: mm(in)712435678NO.2568(Mounting pitch)Bottom view(Mounting pitch)2×2-14(9/16)×20(13/16) Oval hole1Control box34ServicepanelIntakeairIntakeairDischarge airIntakeairIntakeair2×6-ø4.6(3/16) Hole(Make hole at the plastic fan guardfor snow hood attachment)<Snow hood attachment hole>Top viewFront viewLeft side viewRear viewRefrigerant service valve<High pressure>Refrigerant service valve<Low pressure>Connecting pipe specifications*1 Connect the refrigerant pipe to the service valveaccording to the Installation Manual. ModelDiameterRefrigerant pipe Service valve P120ø28.58(1-1/8)ø19.05(3/4) Brazed *1 ø28.58(1-1/8)P96High pressureLow pressureø28.58(1-1/8) Brazed ø22.2(7/8) Brazed *1 P144High pressureLow pressureø22.2(7/8) Brazed *1 For transmission cablesFor wiresFor pipes snoitacificepSegasUFront through holeBottom through holeFront through holeFront through holeBottom through holeBottom through holeFront through hole148(5-7/8) × 84(3-5/16) Knockout hole ø62.7(2-1/2) or ø34.5(1-3/8) Knockout hole ø43.7(1-3/4) or ø22.2(7/8) Knockout hole ø65(2-9/16) Knockout hole ø52(2-1/16) Knockout hole ø34(1-3/8) Knockout hole 150(5-15/16) × 94(3-3/4) Knockout hole ø34(1-3/8) Knockout hole Bottom through hole740(29-3/16)70(2-13/16)150(5-15/16)85(3-3/8)85(3-3/8)130(5-1/8)15018(3/4)1204(47-7/16)181240(48-7/8)110(4-3/8)(740)(29-3/16)185(7-5/16)29.5681(678~684)29.59479181160(6-5/16)243(9-5/8)150128(5-1/16)125132(5-1/4)207(8-3/16)256(10-1/8)109129(5-1/8)84(3-5/16)90(3-9/16)54(2-3/16)135(5-3/8)20(13/16)54591(23-5/16)54(2-3/16)20(13/16)148(5-7/8)152(6)216(8-9/16)166144(5-11/16)3031515(59-11/16)1818(71-5/8)90(3-9/16)1060(41-3/4)90(3-9/16)172(6-13/16)(3-3/4)(3-1/8)(5-15/16)(6-9/16)(7-3/16)(26-13/16)(26-3/4~26-15/16)(1-3/16)(11-15/16)(4-5/16)(4-15/16)(2-3/16)(3/4)(5-15/16)(1-3/16)Note 1. At brazing of pipes, wrap the refrigerant service valve with wet cloth and keep the temperature of refrigerant service valve under 120°C(248°F).MODULE 2: PURY-P144TNU-A(-BS) – DIMENSIONS December 5, 2023 H - 62 )250385<37618$Variable Refrigerant Flow (VRF) Multi-Split AC and HP AHRI Standard 1230 6DWHOOLWH%RXOHYDUG6XZDQHH*$ 7ROO)UHH ZZZPHKYDFFRP Unit: mm (in.)CMY-R300NCBK (337)(13-5/16) 585(23-1/16) 503(19-13/16)162(6-7/16)69 3580 62 ø31.75(ø1-1/4) (Outside diameter) Local brazing Pipe cover (Dot-dashed ø28.58(ø1-3/16) ø28.58(ø1-3/16) ø28.58(ø1-3/16) (Outside diameter) ø34.93(ø1-7/16) Note 2 Twinning pipe ø28.58(ø1-3/16) (Outside diameter) (Outside diameter) High-pressure twinning pipe <Deformed pipe(Accessory)> (Outside diameter) <Deformed pipe(Accessory)> ø41.28(ø1-11/16)ø34.93(ø1-7/16) ø22.2(ø7/8)ø19.05(ø3/4)ø28.58(ø1-3/16) ø19.05(ø3/4) ø19.05(ø3/4) Low-pressure twinning pipe (2 pcs.) (2-3/4) (3-3/16)(1-7/16)(2-1/2) part) Twinning pipe ±15°to the horizontal plane. Note: 1. Refer to the figure below for the installation position of the twinning pipe. 2. Use the attached pipe to braze the port-opening of the twinning pipe. 3. Pipe diameter is indicated by inside diameter. Slope of the twinning pipes are at an angle within ±15° The angle of the twinning pipe is within ±15° against the horizontal plane. 2. Use the attached pipe to braze the port-opening of the twinning pipe. 3. Pipe diameter is indicated by inside diameter. 4. Only use the Twinning pipe by Mitsubishi (optional parts) . Note 1. Reference the attitude angle of the twinning pipe below the fig. Twinning pipe ±15°TWINNING KIT: CMY-R300NCBK – DIMENSIONS 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHGDecember 5, 2023 H - 63 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG -RE1DPH 6\VWHP5HIHUHQFH 'DWH 6SHFL¿FDWLRQV 6\VWHP 8QLW7\SH CMB-P108NU-JA1 ,QGRRU8QLW&DSDFLW\&RQQHFWDEOHWR%UDQFK %78+ 1XPEHU2I%UDQFKHV 8 (OHFWULFDO3RZHU5HTXLUHPHQWV 9SKDVH+] 0LQLPXP&LUFXLW$PSDFLW\ 0&$ $ 0D[LPXP2YHUFXUUHQW3URWHFWLRQ 02&3 $ 3RZHU,QSXW 9 &RROLQJ kW 3RZHU,QSXW 9 +HDWLQJ kW &XUUHQW,QSXW 9 &RROLQJ $ +HDWLQJ $ ([WHUQDO'LPHQVLRQV ,Q>PP@ [[>[ [@ 1HW:HLJKW /EV>NJ@ >@ ([WHUQDO¿QLVK *DOYDQL]HGVWHHOSODWH /RZHUSDUWGUDLQSDQ 3UHFRDWHGJDOYDQL]HGVKHHWV SRZGHUFRDWLQJ &RQQHFWDEOH2XWGRRU+HDW6RXUFH8QLW&DSDFLW\WR )LHOGGUDLQSLSHVL]H ,Q>PP@ 137 5HIULJHUDQW 5$ 6RXQGSRZHUOHYHO PHDVXUHGLQDQHFKRLFURRP 'HIURVW G% $ 6RXQGSUHVVXUHOHYHO PHDVXUHGLQDQHFKRLFURRP 5DWHGRSHUDWLRQ G% $ 'HIURVW G% $ 127(6 7KHHTXLSPHQWLVIRUXVHZLWK5$UHIULJHUDQWRQO\ :KHQSRVVLEOHDYRLGLQVWDOOLQJWKH%&FRQWUROOHUZLWKLQ)WRIVRXQGVHQVLWLYHDUHDV 5DWHGRSHUDWLRQVRXQGGDWDLVEDVHGRQFRROLQJPRGH6RXQGGDWDPD\YDU\GHSHQGLQJRQRXWGRRUXQLWFDSDFLW\DQGRSHUDWLRQPRGH 6RXQGSUHVVXUHSRZHUOHYHOVREWDLQHGYLDWHVWLQJLQDQDQHFKRLFFKDPEHU$FWXDOVRXQGSUHVVXUHOHYHOVPD\EHJUHDWHUGXHWRDPELHQWQRLVHDQGRUGHÀHFWLRQ 6RXQGSUHVVXUHYDOXHVZHUHREWDLQHGDWDWHVWORFDWLRQDSSUR[LPDWHO\)WIURPWKHXQLW 7KHVROHQRLGYDOYHVZLWFKLQJVRXQGSUHVVXUHYDOXHLVG% $ IRUDOOXQLWV 7KHXQLWLVLQWHQGHGIRULQVWDOODWLRQLQDQLQGRRUHQYLURQPHQWRQO\ )RUGHWDLOVUHJDUGLQJLQVWDOODWLRQVSHFL¿FVSOHDVHUHIHUWRWKHSURGXFW¶V,QVWDOODWLRQ0DQXDO CMB-P108NU-JA1 8 BRANCH (MAIN BC) December 5, 2023 H - 64 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG INDOOR UNIT ACCESSORIES: CMB-P108NU-JA1 %DOO9DOYH %DOO9DOYH ´6$(%UD]HG %9%%6, %DOO9DOYH ´6$(%UD]HG %9%%6, &RQGHQVDWH %OXH'LDPRQG $GYDQFHG 0LQL&RQGHQVDWH3XPSZ5HVHUYRLU 6HQVRU 9 >UHFRPPHQGHG@ ; %OXH'LDPRQG 0LFUR%OXH 0LQL&RQGHQVDWH3XPS 9 XSWR%78+ ; 6DXHUPDQQ&RQGHQVDWH3XPS 6, &RQWURO:LUH 01HW&RQWURO:LUH¶5ROO $:*6WDQGDUG7ZLVWHG3DLU6KLHOGHG-DFNHWHG3OHQXPUDWHG &:6 01HW&RQWURO:LUH¶5ROO $:*6WDQGDUG7ZLVWHG3DLU6KLHOGHG-DFNHWHG3OHQXPUDWHG &:6 3RUW$GDSWHU -RLQW3LSH$GDSWHU &0<5- 9DOYHV$GDSWRUV +HDGHUV %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\%78+ &0<56* %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\%78+ &0<56* %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\%78+ &0<56* %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\ %78+ &0<</6* %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\%78+ &0<56* %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\%78+ &0<<6* %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\%78+ &0<<66* %UDQFK-RLQW 'RZQVWUHDPFDSDFLW\%78+ &0<56* 5HGXFHU %HWZHHQ0DLQDQG6XE%& &0<56* 5HGXFHU %HWZHHQ2'8DQG%& &0<56* Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ December 5, 2023 H - 65 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG )250&0%318-$ 6DWHOOLWH%RXOHYDUG6XZDQHH*$ 7ROO)UHH ZZZPHKYDFFRP CMB-P108, 1012, 1016NU-JA1 Unit: mm(in)Connection pipe of outdoor unit(High pressure)ACMB-P108NU-JA1218(8-5/8)(3-5/8)913/4 NPT screw(Emergency draining)XConnection pipe ofSUB BC CONTROLLER(Liquid)(1-7/8)47ø19.05(3/4) (Note 6)Connection pipe ofSUB BC CONTROLLER(Low)3/4 NPT screw(2-11/16)68(9/16)14Detail of X section1456710 11 1314<Accessories>• Square washer (with cushion)•••••••••4pcs.• Square washer•••••••••••••••••••••••••••4pcs.Note 1. Suspension bolt(ø10) and nut(M10) prepare in the field.2. Take notice of service space as shown.(Please give attention not to occupy servicespace by letting ducts and pipes through.)3. Please take service space for connection pipe of SUB BC CONTROLLER.4. Install this product in a location where noise (refrigerant noise)emitted by the unit will not disturb the neighbors.(For use in quiet environments with low background noise, positionthe BC CONTROLLER at least 5m away from any indoor units.)5. Refer to the Installation Manual for refrigerant piping diameter sizewhen connecting plural indoor units with 1 branch.6. Refer to the Table-1,2 connection pipe of outdoor unitor SUB BC CONTROLLER diameter size.7. Refer to the Installation Manual for insulation of connection pipe anddrain piping.8. Do not place the BC controller directly on the floor.(15/16)23 15860(2-3/8)60(2-3/8)×C=D(6-1/8)155Connection pipe ofindoor unit (Gas)Indoor unit model (Note 5)P18 or less: ø12.7(1/2)<Brazed>P18 over: ø15.88(5/8)<Brazed>80(3-3/16)Service space(8-13/16)223(6-1/8)15560(2-3/8)25(1)AB(Lifting bolt pitch)60(2-3/8)×C=DConnection pipe ofindoor unit (Liquid)Indoor unit model (Note 5)P18 or less: ø6.35(1/4)<Brazed>P18 over: ø9.52(3/8)<Brazed>Servicespace(1-7/8)47(17-3/4)450AccessdoorE(9-7/8)250ø38.1(1-1/2) (Note 6)ø34.93(1-3/8) (Note 6)Connection pipe of outdoor unit(Low pressure)ø38.1(1-1/2) (Note 6)Control box911(35-7/8)CMB-P1012NU-JA197D983(38-3/4)660(26)CMB-P1016NU-JA1(3-7/8)E231(9-1/8)343(13-9/16)343(13-9/16)Connection pipe ofSUB BC CONTROLLER(High pressure)ø28.58(1-1/8) (Note 6)(11-13/16)300Table-1. To outdoor/heat source unit (Note.6)High press. PipeConnectableunit capacityP72P96P120P240P312P336ø15.88(5/8)ø19.05(3/4)ø19.05(3/4)P144 to P192P216ø22.2(7/8) or ø28.58(1-1/8)ø22.2(7/8) or ø28.58(1-1/8)P264 to P288ø28.58(1-1/8)ø28.58(1-1/8)Table-2. To other BC controller (Note.6)Low press. Pipeø19.05(3/4)ø22.2(7/8)ø22.2(7/8) or ø28.58(1-1/8)ø28.58(1-1/8)ø28.58(1-1/8)ø34.93(1-3/8)ø34.93(1-3/8)ø34.93(1-3/8) or ø41.28(1-5/8)ø41.28(1-5/8)*For the refrigerant pipe size, refer to Installation Manual of outdoor units/heat source units.****Total downstreamIndoor unit capacity~P72P73~108P109~126P127~144P145~216P217~234P235~288P289~360P361~High press. Pipeø15.88(5/8)ø19.05(3/4)ø19.05(3/4)ø22.2(7/8)ø22.2(7/8)ø28.58(1-1/8)ø28.58(1-1/8)ø28.58(1-1/8)ø34.93(1-3/8)ø9.52(3/8)ø9.52(3/8)ø12.7(1/2)ø12.7(1/2)ø15.88(5/8)ø15.88(5/8)ø19.05(3/4)ø19.05(3/4)ø19.05(3/4)Low press. Pipeø19.05(3/4)ø22.2(7/8)ø28.58(1-1/8)ø28.58(1-1/8)ø28.58(1-1/8)ø28.58(1-1/8)ø34.93(1-3/8)ø41.28(1-5/8)ø41.28(1-5/8)(1-3/16) (1/2) 30 12273(10-3/4)252(9-15/16)22(7/8)264(10-7/16)342(13-1/2)(1-5/8)(12-11/16)41323(Lifting bolt pitch)463(18-1/4)545(21-1/2)264(10-7/16)325 (12-13/16)379 (14-15/16)(3-1/16)77(7-7/8)200(3-15/16)100(9-7/8)250(17-3/4)450700(27-3/8)1135(44-11/16)1135(44-11/16)B1207(47-9/16)1207(47-9/16)C71115420(16-9/16)900(35-7/16)15 16128923(6-1/4)(7-7/16)188204(8-1/16)Liquid Pipeø22.2(7/8)ø28.58(1-1/8)INDOOR UNIT DIMENSIONS: CMB-P108NU-JA1 December 5, 2023 H - 66 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG -RE1DPH 6\VWHP5HIHUHQFH 'DWH *(1(5$/)($785(6 /RVVQD\ ®FURVVÀRZHQHUJ\UHFRYHU\FRUH 0LQLPDOFURVVFRQWDPLQDWLRQEHWZHHQHQWHULQJDQGOHDYLQJDLUVWUHDPV 6WDQGDORQHUHPRWHFRQWUROOHU 3='5($ 01(7&RQQHFWLYLW\ ([WHUQDOLQSXWE\SDVVGDPSHUFRQWURO 6WDQGDORQHRULQWHUORFNVFRQQHFWVZLWKDOO0LWVXELVKL(OHFWULFSURGXFWV )RXUIDQVSHHGV +LJKHI¿FLHQF\'&0RWRU 6WDQGDUG0(59QRQZRYHQIDEULF¿OWHUZDVKDEOH¿EHU 2SWLRQDOKLJKHI¿FLHQF\0(59DQG0(59¿OWHUV 6SHFL¿FDWLRQV 6\VWHP 8QLW7\SH LGH-F600RVX2-E &DSDFLW\&)0>PK@ > @ 3RZHUVRXUFH 9ROWDJH3KDVH+HUW]9SKDVH+] 3RZHU&RQVXPSWLRQ N: &XUUHQW $ 6WDUWLQJ&XUUHQW $ 0&$$ 0D[LPXP2YHUFXUUHQW3URWHFWLRQ 02&3 $ )DQ $LU9ROXPH &)0>PK@ > @ ([WHUQDO6WDWLFSUHVVXUH LQ:*±±± ([FKDQJH(I¿FLHQF\ 7HPSHUDWXUH % (QWKDOS\&RROLQJ % (QWKDOS\+HDWLQJ % ([WHUQDO)LQLVK *DOYDQL]HGVWHHOVKHHW ([WHUQDO'LPHQVLRQV ,Q>PP@ [[ >[[@ 1HWZHLJKW /EV>NJ@ >@ (QHUJ\7UDQVIHU0HFKDQLVP /RVVQD\®&RUH +HDW([FKDQJH0DWHULDO 3DUWLWLRQVSDFLQJSODWHFHOOXORVH¿EHUPHPEUDQH +HDW([FKDQJH6\VWHP $LUWRDLUWRWDOKHDW VHQVLEOHKHDWODWHQWKHDW H[FKDQJHQRPRYLQJSDUWV %ORZHU7\SH ,QGLDPHWHUFHQWULIXJDOIDQ 0RWRU7\SH (&0RWRU (QWHULQJ$LU7HPSHUDWXUH2SHUDWLRQ5DQJH )>&@ WR>WR@ 6RXQGSUHVVXUHOHYHO G% $ ±± LGH-F600RVX2-E ENERGY RECOVERY VENTILATION December 5, 2023 H - 67 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG ACCESSORIES: LGH-F600RVX2-E :LUHG5HPRWH&RQWUROOHU /RVVQD\®(595HPRWH&RQWUROOHU 3='5($ &RQWURO,QWHUIDFH 6LJQDO2XWSXW7HUPLQDO 3=*6( 'XFW$FFHVVRULHV 'XFW6LOHQFHU 3=66( )LOWHU 0(59)LOWHU 3=5)3( 0(59)LOWHU 3=5)3( 0(59)LOWHU ,QFOXGHG 3=5) ( 5HPRWH6HQVRU &26HQVRU%XLOW,Q 3=&6%( &26HQVRU:DOO0RXQW 3=&6:( Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ Ƒ December 5, 2023 H - 68 6SHFL¿FDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH0LWVXELVKL(OHFWULF7UDQH+9$&86//&$OOULJKWVUHVHUYHG )250/*+)59;( 6DWHOOLWH%RXOHYDUG6XZDQHH*$ 7ROO)UHH ZZZPHKYDFFRP UNIT SCALE inch(mm) N.T.S DIMENSIONS: LGH-F600RVX2-E December 5, 2023 H - 69 12 9 Diverse Business Enterprise Utilization Trane’s Diverse Business Outreach Plan includes all Diverse Business, HUBZONE Business, Diverse Disadvantaged Business, Minority Business Enterprise, Women Business Enterprise, Veteran-Owned Businesses, Small Business Enterprise, and Service Disabled Veteran-Owned Diverse Businesses, (SB, HUBZone, SDB, MBE, WBE, VOSB, SBE, and SDVOSB). The plan is designed to maximize the participation by these business enterprise contractors and vendors on all Washington State Department of Enterprise Services projects and is in compliance with Part 10.15 of the General Conditions of the MESA. This Diverse Business Outreach Plan complies with WA DES guidelines and incorporates many of Trane’s subcontracting processes already in place. Trane’s Diverse Business Enterprise goals and utilization for this project are listed below. Trane was unable to engage diverse businesses on this project. TABLE 9.1',9(56(%86,1(6687,/,=$7,21 INVESTMENT GRADE AUDIT GOAL UTILIZATION MINORITY OWNED BUSINESS 12% 0% WOMAN OWNED BUSINESS 8% 0% VETERAN OWNED BUSINESS 5% 0% SMALL/MINI/MICRO BUSINESS 5% 0% CONSTRUCTION GOAL UTILIZATION MINORITY OWNED BUSINESS 12% 0% WOMAN OWNED BUSINESS 8% 0% VETERAN OWNED BUSINESS 5% 0% SMALL/MINI/MICRO BUSINESS 5% 0% December 5, 2023 H - 70 Energy Savings Proposal Prepared by: Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 November 28, 2023 City of Port Angeles Senior Center Energy Upgrades Phase 2: Solar & Storage 328 E 7th St Port Angeles, WA 98362 DES Audit Agreement # 23-227 c/o Department of Enterprise Services 1500 Jefferson Street SE PO Box 41012 Olympia, WA 98504-1012 Website: www.des.wa.gov December 5, 2023 H - 71 1 CONTACTS Site Contact The following facility personnel assisted with this report: Corey Delikat Director of Parks & Recreation City of Port Angeles 308 East 4th Street Port Angeles, WA 98362 Direct: (360) 417-4551 Email: Cdelikat@cityofpa.us Department of Enterprise Services Contact The DES Project Manager (PM) is: Novella Randall Project Manager Washington State Department of Enterprise Services 1500 Jefferson Street Southeast Olympia, Washington 98501 Phone: 360-790-3667 E-mail: novella.randall@des.wa.gov Utility Contact Gregg King Power Resources Manager 321 E 5th St Port Angeles, WA 98362 Phone: 360-417-4710 E-mail: gking@cityofpa.us ESCO Contact Information The Energy Savings Company (ESCO) that prepared this report are: Greg Stinson Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 Phone: (425) 256-1717 E-mail: Greg.Stinson@tranetechnologies.com December 5, 2023 H - 72 2 Table of Contents 1 Executive Summary ............................................................................................................. 3 Project Overview .......................................................................................................... 3 Selected Energy Conservation Measures Summary .................................................... 4 1.2.1 ECMs Considered but Deferred ............................................................................ 4 Project Costs and Benefits ........................................................................................... 4 Conclusion ................................................................................................................... 4 2 Financial Analysis ................................................................................................................ 5 Maximum Project Allowable Costs ............................................................................... 5 Items Included in Maximum Project Cost ..................................................................... 5 Project Contingency ..................................................................................................... 6 Allowances .................................................................................................................. 7 Measurement & Verification (M&V) .............................................................................. 7 Reconciliation of Construction Costs ............................................................................ 8 Energy Services Company (ESCO) Compensation ...................................................... 8 Payment Terms ...................................................................................................................... 8 Finance Charges on Unpaid Balance ..................................................................................... 8 Substantial and Final Completion ........................................................................................... 8 Terms of Agreement .................................................................................................... 9 3 Scope of Work ................................................................................................................... 11 Energy Conservation Measures Narrative ...................................................................11 ESCO Services ...........................................................................................................11 Project Schedule .........................................................................................................13 Detailed Scope of Work ..............................................................................................13 4 Energy and Performance Guarantee .................................................................................. 16 Savings and Project Incentives ...................................................................................16 4.1.1 Annual Utility Cost Savings ..................................................................................16 4.1.2 Annual Maintenance/Operations Costs Impact ....................................................16 Detailed Energy Calculations ......................................................................................16 Utility Data ..................................................................................................................16 Energy and Performance Guarantee ..........................................................................17 Measurement and Verification (M&V) Plan .................................................................19 December 5, 2023 H - 73 3 1 Executive Summary Project Overview Trane is pleased to provide the following Energy Services Proposal (ESP) for installing a solar array and storage at the City of Port Angeles’s Senior Center. The scope and costs herein reflect Trane’s work to date and are proposed as the guaranteed maximum (GMAX) project cost and guaranteed minimum savings per the State’s Energy Savings Performance Contracting (ESPC) program. The City of Port Angeles selected Trane US Inc. to complete an Investment Grade Audit (IGA) of the Facility through the State’s ESPC program, administered by the State of Washington’s Department of Enterprise Services (DES). This phase of the IGA focused on adding on site energy production and resilience using solar and battery storage. The proposed measure will produce energy and reduce utility costs. The key objectives the Owner identified for this project are: Reduce energy costs by generating their own power Avoid facility downtime from power outages Provide resiliency to the community during power outages Maximize system life and reliability Specified equipment maximizes operational efficiencies and requires less routine maintenance Maximize energy conservation incentives from City Power Trane completed the Investment Grade Audit (IGA) of the Senior Center. Through this IGA, Trane has presented the City of Port Angeles with a project solution that improves resilience, addresses capital improvement needs, meets the Cost Effectiveness Criteria and maximizes energy efficiency. This project includes upgrades and renovations to various systems within the Senior Center as outlined in Section 1.2. December 5, 2023 H - 74 4 Selected Energy Conservation Measures Summary ECM-3 Senior Center Solar Array and Backup Battery The intent of this measure is to install a 50-kW solar array on the Senior Center roof and add a 200 kWh / 50-kW Lithium-ion battery backup system to provide resiliency in case of power outages. The solar array will be attached to the existing standing seam metal roof that has sufficient durability to support the solar array for its lifetime. The battery will be installed exterior to the building in the driveway next to the electrical room. The battery will be installed in an outdoor rated enclosure. The battery will come with automated transfer switches that will automatically shift critical loads from the grid to the battery in the case of a power outage. 1.2.1 ECMs Considered but Deferred There were measures investigated during the IGA but are not a part of this ESP. Details about these measures can be found in section 3 of IGA report dated November 28, 2023. Project Costs and Benefits Trane guarantees that the Maximum Project Cost will not exceed $1,039,822. Sales tax, the Department of Enterprise Service’s fees and utility incentives are not guaranteed nor are they incorporated in the Maximum Project Cost. Total project cost inclusive of sales tax and Department of Enterprise Service’s fee is $1,044,022. Refer to Section 2 of this ESP for further details. Price is valid for 30 days. This project will generate the following benefits for the City of Port Angeles: Achieve guaranteed annual energy production totaling 47,205 kWh Achieve annual utility cost avoidance totaling $2,832 per year Potentially qualify for energy conservation incentives from City’s Utility Improve system and equipment reliability Conclusion Trane appreciates the opportunity to present this ESP. The measures described in this proposal demonstrate that the City of Port Angeles is actively working to optimize operations and minimize energy and operational costs. Trane looks forward to working with City of Port Angeles Staff and the Department of Enterprise Services on the implementation of this project. December 5, 2023 H - 75 5 2 Financial Analysis The investment grade audit (IGA) was used to develop the costs for the proposed ECMs. Table 2.1, Budget Summary, presents open book financials of the project. Maximum Project Allowable Costs Trane guarantees that the Maximum Project Cost will not exceed $1,039,822. Sales tax, the Department of Enterprise Service’s fees and utility incentives are not guaranteed nor are they incorporated in the Maximum Project Cost. Total project cost inclusive of sales tax and Department of Enterprise Service’s fee is $1,044,864. Refer to Table 2.1 in this section of the ESP for further details. Items Included in Maximum Project Cost Maximum Project Cost includes the following: 1. Investment Grade Audit 2. Engineering a. 10% of labor and materials (not including Project Site Resources) for design service 3. Construction Management Services a. 6% of labor and materials for construction management/administration b. All activities and services required to manage Trane’s labor force or its Subcontractors for the purchase and installation of the equipment as applicable in the Construction Contract. These include but are not limited to contract administration, preparation of meeting minutes, schedule creation, issuance of request for proposals (RFP), submittal processing, purchasing, invoicing, development and delivery of as-built drawings and creation and delivery of project closeout documents. This is not supervision as provided by the Site Superintendent. 4. Measurement and Verification Fee (One year only) 5. Project Contingency 6. Installation cost includes: a. All costs paid by Trane for the installation of the Project equipment. This includes costs paid to subcontractors or directly to Trane personnel, when related to installation or system verification of Project equipment. b. Site Supervision includes, but is not limited to, all activities executed by an employee of the ESCO in the active supervision of its own labor force and its subcontractors, coordination of craft laborers’ work, schedules, as-needed daily work progress reports, quality controls, site security, creation and enforcement of the site-specific safety plan, coordination with site tenants and other tasks that can only be effectively performed onsite. Site Supervision activities do not include Construction Management. Examples of substantiated hours include: i. when the project superintendent/site supervisor is on site and doing the previously mentioned site supervision activities. ii. when the project manager is on site or coordinating on site work while off site iii. when the safety manager is conducting safety audits, developing the safety plan, or providing supervision on site December 5, 2023 H - 76 6 c. The portion of reasonable travel, lodging and meals expenses of Trane or of its officers or employees incurred while traveling in discharge of duties connected with the Work in accordance with Section C of the Main Energy Services Agreement (MESA). (Applicable only on projects more than 50 miles from Trane’s office). d. Cost of all equipment, materials, supplies, and equipment incorporated in the Work, including costs of transportation thereof in accordance with the MESA. e. Cost of premiums for all bonds and insurance, which Trane is required to purchase and maintain. f. Permit fees, royalties and deposits lost for causes other than Trane’s negligence. g. Sales, use, or similar taxes related to the Work and for which Trane is required to purchase and maintain. h. Losses and expenses not compensated by insurance or otherwise, sustained by Trane in connection with the work, provided they have resulted from causes other than the fault or neglect of Trane or its subcontractors. Such losses shall include settlements made with the written consent and approval of the Owner and the DES project manager. If, however, such loss requires reconstruction and Trane is placed in charge thereof, Trane shall be compensated for such services. i. Reimbursable expenses as contemplated in Section III C of the MESA. j. Demolition cost and cost of removal of all debris unless specifically excluded in the Scope of Work. k. Other costs incurred in the performance of the Work if and to the extent approved in advance in writing by the Owner. l. Contingency and Allowances as defined in Sections 2.3 and 2.4 of this ESP m. Cost of equipment startup, training, system verification, commissioning and balancing performed by Trane. n. Metering equipment costs for any permanent metering or monitoring equipment left on site. o. Trane shall provide a Schedule of Values prior to first payment application. The schedule of values will include all costs related to the installation of equipment, with the exclusion of fixed fee items. Fixed fee items include the IGA fee, Design, Construction Management, Overhead and Profit listed in Table 2.1 of this ESP. 7. Construction Bonds, Liability Insurance and Builder’s Risk Insurance. a. 1.5% of construction costs as defined in the ESP for bonding 8. For projects over $1 million, the apprenticeship incentive is added 9. Trane fee. This includes Trane’s remuneration overhead and profit. This is a fixed fee. a. 18% of labor and materials for overhead and profit Project Contingency A project contingency as identified in Table 2.1, Project Cost, has been established for this project. Trane can expend the amount of contingency listed in the executed change order after a change order has been approved by the Owner and DES for items necessary to complete the original scope of this project. The intent of the contingency is for “unforeseen conditions” beyond what was originally estimated. Any construction period financing costs shall also be paid from this fund. Trane shall be allowed to mark-up contingency funds expended for this project in accordance with the General Conditions of the MESA and at rates defined in Table 2.1. Trane, the DES and December 5, 2023 H - 77 7 the Owner will jointly manage any contingency left after the project scope is completed. All unused project contingency funds shall reduce the overall project cost to the Owner. Allowances As agreed by the Owner and DES, Trane may set aside allowances that will be identified in Table 2.1, Project Cost, for specific areas of work that are a potential cost impact but cannot be determined during the IGA. Should the agreed upon allowance not be adequate, the Owner and DES will be advised and Trane may be compensated for any additional costs via Change Order to the Contract subject to adequate substantiation and agreement by the Owner and DES. If actual costs for scope identified as allowance are less than the allowance amount in Table 2.1, the difference will be allocated to Contingency. In extreme situations, Trane may request additional funds via change order to cover cost overruns that could not have been foreseen by either party. Any change orders are subject to approval by the Owner and DES. No allowance value has been identified for this project. For this project, an escalation allowance is held in Table 2.1. The intent of that allowance is to capture additional costs for a) material escalation greater than 5% from the date of this proposal to when material is ordered, which is after the submittal and permitting processes, or b) any new tariffs. Funding Sources Washington State Department of Commerce Grant The City of Port Angeles was awarded a $500,000 grant from the Washington State Department of Commerce’s Solar plus Storage for Resilient Communities program in August 2023. The grant requires filling out several intake forms. Federal Investment Tax Credit As part of the 2022 Inflation Reduction Act, the Federal US government created the possibility for non-tax paying entities like the City to receive direct pay Investment Tax Credits. The tax credit starts at 30% if the job is installed using prevailing wage labor. There is a 10% adder if the project is constructed using American made materials according to the BABA regulations. There is a further 10% increase for low-income communities. Communities need to apply to the Department of Energy for the 10% increase, which is comprised of a limited amount of money per year. The grant application window opened October 19, 2023. More information can be found at Low-Income Communities Bonus Credit Program | Department of Energy. Measurement & Verification (M&V) One (1) year of Measurement and Verification (M&V) is included for this project as defined in Section 4.5 of this ESP and consistent with the MESA. No other on-going services have been proposed. December 5, 2023 H - 78 8 Reconciliation of Construction Costs The guaranteed maximum project cost is based on firm negotiated bids or estimated Labor & Material costs developed by Trane. In recognition that actual construction costs may vary from the estimate, the following procedures are established to reconcile this difference: 1. If actual total Labor & Material costs exceed the estimated Labor & Material costs (plus Contingency), the additional expense will be borne by Trane without affecting the Owner’s payment. 2. If actual total Labor & Material costs are less than the estimated Labor & Material costs (plus Contingency), the remaining funds will be retained by the Owner. Energy Services Company (ESCO) Compensation Payment Terms Owner shall pay Trane or cause Trane to be paid for the Services as follows and in accordance with the MESA (this may be modified by funding source requirements and client reimbursement schedules): 1. Initial Payment - Upon receipt of notice to proceed and an executed contract, Trane will invoice for the following: a. Investment Grade Audit fee b. Other fees as appropriate including a portion of design, construction management and bonding 2. Monthly Progress Billing will commence after filing intent and if necessary, an apprenticeship plan, a. All materials and equipment delivered to the Premises and stored in a secure and insured location (or, as applicable, to an off-site storage facility as detailed in DES General Conditions Section 6.05, item D) b. All installation, labor and ESCO Fees performed, less project retention (if applicable) c. As approved by Owner and DES 3. Final Payment - Project Retention (if applicable) DES will review all invoices, and forward them to the Owner. Owner shall pay all amounts due upon receipt of the invoice unless the Owner has concerns or needs additional information about the invoice. The Owner may request this information within (8) days in accordance with RCW 39.76. Any invoice not paid within thirty (30) calendar days after submittal of all requested material shall be past due. Finance Charges on Unpaid Balance All amounts outstanding thirty (30) calendar days after the Owner receives all requested information shall bear interest payable to Trane at a rate of 1 percent per month per RCW 39.76.011. Substantial and Final Completion Unless a retention bond is used, retention will be released within (45) days after receipt of all lien releases, L&I, Revenue and Employment Security certificates and releases by the Owner. December 5, 2023 H - 79 9 When Trane considers that the Services, or a portion thereof, are substantially complete, Trane will submit to the Owner and DES a proposed “punch list” listing items of the Services to be completed prior to final completion. Owner, DES and Trane shall inspect the Services (or portion thereof) to determine if the same is substantially complete. Substantial Completion is defined in the General Conditions of the MESA. Terms of Agreement The contract shall be effective and binding upon its execution and the period from contract execution until the Commencement Date shall be known as the “Interim Period.” All energy savings achieved during the interim period will be fully credited to Owner. The total project cost is valid if a construction contract has been issued to Trane on or before 12/28/2023. If the contracts are received after this date, Trane reserves the right to review and update total project costs based on updated project initiation date. December 5, 2023 H - 80 TABLE 2.1 - PROJECT COST City of Port Angeles Senior Center Solar & Storage A. CONSTRUCTION COSTS Costs ECM-3 Senior Center Solar Array + Battery 631,769$ Commissioning 3,135$ Reimbursable Expenses (Lodging, Per Diem, etc.)13,302$ Safety, Site Conditions 12,111$ Project Site Resources 47,383$ Subtotal Labor and Materials Cost 707,699$ Construction Bond 1.50%10,615$ TOTAL CONSTRUCTION COST 718,315$ B. ESCO FEES IGA + Structural Review -$ Design Fee [10% * (Total Construction Cost - Supervision - Reimbursibles - Safety)] 10.0%70,770$ Construction Mgmt. [6% * (Total Construction Cost - Bond - Supervision - Reimbursables - Safety)] 6%42,462$ Overhead [11%*(Total Construction Cost - Bond - Supervision - Reimbursibles - Safety)] 11%77,847$ Apprenticeship Incentive 1,000$ Profit [7%*(Total Construction Cost - Bond - Supervision - Reimbursibles - Safety)] 7%49,539$ TOTAL ESCO FEES 241,618$ C. OTHER COSTS Project Contingency 5.0%47,997$ Escalation Allowance 30,000$ ESCO M&V Costs (Year 1)1,893$ TOTAL OTHER COSTS 79,890$ D. TOTAL GUARANTEED CONSTRUCTION & ESCO SERVICES 1,039,822$ E. NON-GUARANTEED COSTS DES Fee 4,200$ Tax (Solar system is tax exempt.)8.9%-$ TOTAL NON GUARANTEED COSTS 4,200$ F. TOTAL PROJECT COST 1,044,022$ December 5, 2023 H - 81 11 3 Scope of Work TRANE identified opportunities to increase energy efficiency at the City of Port Angeles Senior Center during the course of the IGA. City of Port Angeles Staff have been heavily involved throughout the IGA and the resulting scope of work reflects short and long term goals of the City of Port Angeles. The detailed IGA concluded that the most effective way of meeting the City of Port Angeles’s objectives of promoting energy efficiency would be to implement the ECMs in this ESP. Energy Conservation Measures Narrative The proposed Energy Savings Performance Contract (ESPC) consists of the following Energy Conservation Measures (ECMs), which were prioritized based upon the results of the IGA and agreed upon by the Owner. Further detail on the scope of work is in Section 3.4 of this ESP. ECM-3 Senior Center Solar Array and Backup Battery The intent of this measure is to install a 50-kW solar array on the Senior Center roof and add a 200 kWh / 50 kW Lithium-ion battery backup system to provide resiliency in case of power outages. The solar array will be attached to the existing standing seam metal roof that has sufficient durability to support the solar array for its lifetime. The battery will be installed in the driveway on the northwest side of the Senior Center in an outdoor rated enclosure. The battery will provide backup to an electrical panel that will ensure the HVAC equipment serving the multi-purpose room and most of the lights in the building will remain on in the event of a power outage. The following order of precedence has been established for the scope of work documents in this ESP: 1) Preliminary Design Documents located in Section 7 of the IGA Report. 2) The Scope of Work Narrative located in this Section of this ESP. ESCO Services Trane will provide the following services related to this project: 1. ENERGY AUDIT The energy audit portion of this project is complete and can be found in the Investment Grade Audit report dated November 28, 2023. 2. DESIGN SERVICES Trane will provide design services as needed to construct the project and obtain permitting (mechanical, electrical, etc.), Owner review, and approval of the proposed system and to obtain competitive bids as appropriate for the project. In addition, Trane will also provide construction support services, start-up, testing and as-built drawings of systems installed both in electronic (MS Office and AutoCAD) and two full-sized hard paper copies to the Owner. December 5, 2023 H - 82 12 3. CONSTRUCTION Provide, or cause to be provided, all material, labor and equipment, including permits, fees, bonds and insurance, required for the complete and working installation of equipment. a. Trane will provide site resources that will be responsible for the onsite supervision and coordination of trades and subcontractors. These individual’s responsibilities will also include regular work observations, quality control, site security, enforcement of the site-specific safety plan, as well as coordinating any impact upon process or occupancy schedules with the Owner. b. Trane will provide site specific safety plan prepared and audited by our Environmental Health and Safety (EHS) Manager in addition to the site superintendent. c. Trane may perform portions of the construction work with the approval of the Owner and DES or may subcontract portions to qualified firms. In either case, Trane will share information regarding actual costs of the work with the Owner and DES. d. When Trane has completed the ECM, including start-up, operations verification and training in accordance with the proposal, DES and Trane will provide the Owner a “Notice of Substantial Completion” and “Notice of Commencement of Energy Savings.” e. At the conclusion of the project, DES and Trane will submit a “Notice of Final Completion” to the Owner. 4. CONSTRUCTION MANAGEMENT Trane will provide a construction manager who will provide contract administration services for the project. The Owner is expected to coordinate day-to-day communications with tenants and any scheduling of tenant relocations in and around occupied areas. 5. OPERATION TRAINING Trane will provide training of staff after startup and commissioning. This proposal includes training sessions for all major equipment and controls to be held at the project site. 6. MEASUREMENT AND VERIFICATION (M&V) Trane will provide measurement and verification to ensure that guaranteed savings are achieved throughout the term of the agreement. Additional on-going services shall be under separate agreement. Specific measurement and verification tasks associated with this project can be found in Section 4 of this ESP. 7. SYSTEM COMMISSIONING Refer to the Detailed Scope of Work in this section of the ESP for system commissioning requirements. 8. EQUIPMENT MAINTENANCE Trane will provide no equipment maintenance or repairs after the warranty period. Following the completion of the installation and acceptance by the Owner of the equipment, the Owner shall provide all necessary service, repairs and adjustments to the equipment so that the equipment will perform in the manner and to the extent set December 5, 2023 H - 83 13 forth in the proposal. Trane shall have no obligation to service or maintain the equipment after the warranty period. 9. WARRANTY Trane will warrant equipment, material, design, and workmanship for one year following receipt of client’s acceptance of “Notice of Commencement of Energy Savings” by ECM as outlined in Section 5.24 of ESPC General Conditions. Specific information regarding equipment warranty will be passed on to the Owner. 10. HAZARDOUS WASTE Should the project require removal or disposal of hazardous material, Trane will comply with section 5.20 of the ESP General Conditions. Prior to construction start, the Owner will provide to Trane their Hazardous Materials Survey or Good Faith Statement as to the presence of such materials. The costs for removal and disposal of any hazardous materials that have not been identified during the IGA and are discovered during construction are not included in the guaranteed maximum cost. The Owner agrees and acknowledges that it has not relied on or employed Trane to analyze or identify the presence of any hazardous substance on the Owner’s premises. Project Schedule Trane will develop a final Project Schedule once a Notice to Proceed has been received from the DES. Substantial completion is estimated within (240) calendar days after receipt of the Notice to Proceed from DES. Detailed Scope of Work Refer to the following ‘Detailed Scope of Work’ narrative located in this section of the ESP as well as the preliminary design drawings located in Section 7 of the IGA Report for further detail. The following order of precedence has been established for the scope of work documents in this ESP. 1) Preliminary Design Documents located in Section 7 of the IGA Report. 2) The Scope of Work Narrative located in this Section of this ESP. This project has multiple phases to allow for continuous occupancy by the staff, which is necessary due to the critical nature of this site and the need to conduct business as usual during construction. Applicable building, mechanical, energy or other pertinent state and local codes that may impact the project costs include: 1. International Energy Conservation Code 2020 Edition 2. State Building Code Adoption and Amendment of the International Mechanical Code, 2021 Edition 3. Washington State Energy Code 2021 Edition 4. State Building Code Adoption and Amendment of the Uniform Plumbing Code, 2018 Edition and Appendices A, B, and I. a. Excluding chapters 12 & 15 December 5, 2023 H - 84 14 b. Excluding Combustion Air and Ventilation of Appliances in Chapter 5 c. Excluding Portions of the Code Addressing Building Sewers 5. The National Electric Code, 2020 Edition, as published by the National Fire Protection Association Scope of Work ECM-3: Senior Center Solar & Storage 1. Solar Contractor a. Engineering i. Provide electrical shop drawings. ii. Provide structural load study and electrical engineering stamps. b. Provide and install photovoltaic (PV) rooftop system including: i. (118) Hanwha 425W photovoltaic modules (50.15kW DC) ii. SolarEdge rapid shutdown compliant optimizers (located beneath modules) iii. (1) SolarEdge 50 kW (AC) 208V 3-phase inverter iv. Ironridge Flush Mount racking system with S-5! metal seam roof clamps v. SolarEdge web-based monitoring system vi. PV-related wire and raceway conduit between PV modules and connection to electrical distribution system c. Provide and install battery energy storage system (BESS) i. Batteries 1. (40) 5kWh Endur batteries (200 kWh) 2. Novec fire suppression ii. Inverter and Controller 1. (2) Sol-Ark 30kW 208V storage inverter (60kW) with integrated network protection relay and microgrid controller 2. Time of Use Shifting functionality 3. Islanding iii. Back-up loads 1. (2) 60A breakers for HVAC units for emergency services during heat event iv. BESS-related wire and raceway conduit and between BESS system and connection to electrical distribution system d. Building and electrical permitting, plan review, and inspection i. Provide training and assistance with utility paperwork. e. Testing i. Confirm modules are producing as expected f. Commissioning i. Functional testing will be performed during the startup of the PV and battery systems 2. General Contractor a. New Battery Concrete Pad i. Sawcut existing concrete driveway for new concrete pad. ii. Disposal of concrete. iii. Compact existing soil form and tie rebar (#5) mat for new battery pad. iv. Pour 4000 psi concrete pad (10’ x 7’) for Batteries. v. Broom Finish (concrete pad). b. Chain link fencing around Battery pad with green privacy slats December 5, 2023 H - 85 15 Clarifications/Exclusions 1. Replacement of any equipment or system except those components specified above is not included. It is assumed that the existing equipment to remain is functioning per City of Port Angeles staff, latest record drawings and manufacturer specs. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/28/2023. 2. This proposal is based on completing the work during normal working hours and does not include shift differential. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/28/2023. 3. This proposal is based on performing the work in accordance with the enclosed construction duration of 300 days and will require some service outages. During the course of the required outages Trane will work with the City of Port Angeles to maintain a healthy and safe environment. Due to the nature of the working environment and variability in daily flow, Trane makes no guarantees for events out of our control. 4. This proposal is based on preparations to purchase, receive, handle, and stage material on site as well as to place construction debris in a dumpster located on site by Trane if required. 5. This proposal does not include any extra equipment or materials. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/28/2023. 6. This proposal does not include hazardous material removal and/or abatement (asbestos, mold, lead, etc.). It is assumed that the City of Port Angeles will bear any costs associated with hazardous material identification and abatement. 7. Code upgrades other than those needed to complete the project are not included. 8. This proposal does not include any work on systems other than what is required for a complete installation and testing of the measures identified in this proposal. This Clarification/Exclusion has been discussed with the City of Port Angeles and they agree on 11/28/2023. 9. This proposal assumes that existing equipment and systems are currently under control, properly maintained and in good working order. This proposal does not include performance of any repairs or maintenance on said existing equipment. 10. As between Customer, Trane and the Original Equipment Manufacturer (the “Solar OEM”) of the solar photovoltaic panels (“Solar Panels”) installed by Trane hereunder, neither Trane nor the Solar OEM shall have any liability or obligation to pay or be responsible for recycling, decommissioning, reusing, disposing, or other similar obligations (“End of Life Obligations”) with respect to the Solar Panels or the balance of the solar system. Customer will impose the restrictions set forth in this Section on any and all successive purchasers of the Solar Panels and the balance of the solar system with whom Customer shall have direct privity of contract and shall require such successive purchasers to impose these restrictions by contract on their successive purchasers. If any End of Life Obligations are imposed on Trane or the Solar OEM for the Solar Panels or the balance of the solar system sold, provided and/or installed by Trane under this Agreement, the parties agree to work together in good faith among each other and the Solar OEM (as applicable) for appropriate and reasonable remedies with respect to such End of Life Obligations that honor the intent of this provision. December 5, 2023 H - 86 16 4 Energy and Performance Guarantee Savings and Project Incentives 4.1.1 Annual Utility Cost Savings ECM-3 will create guaranteed annual savings (90% of calculated) for City of Port Angeles: ECM-3: $2,832 (47,205 kWh) The 100% calculated annual savings from these reductions is: ECM-3: $3,147 (52,450 kWh) 4.1.2 Annual Maintenance/Operations Costs Impact The ECM in this proposal will result in annual maintenance and operation cost savings for City of Port Angeles as the upgrade includes new equipment. These O&M savings have not been quantified. Detailed Energy Calculations Please refer to Section 6 of the IGA report dated November 28, 2023 for further detail regarding energy savings calculations. Table 4.1 provides a summary of calculated and guaranteed energy savings by ECM. Energy Conservation Measure (ECM) Calculated kWh Savings (100%) Guaranteed kWh Savings (90%) ECM 3. Install Solar and Batteries at Senior Center 52,450 47,205 TABLE 4.1: SUMMARY OF SAVINGS BY ECM Utility Data Please refer to Section 5 of the IGA report dated November 28, 2023 for further detail regarding historical utility data for City of Port Angeles. Table 2 is a summary of annual energy usage for the Senior Center. Table 3 defines the base and floor electrical utility rate used in this ESP and for the Guarantee Term. Building Annual electric (kWh) Annual electric cost Senior Center 311,040 $18,662 TABLE 4.2: ENERGY USE SUMMARY Building Utility Provider Electricity Cost ($/kWh) Electric Demand ($/kW) Senior Center City of PA $0.052 $4.50 TABLE 4.3: UTILITY RATE December 5, 2023 H - 87 17 Energy and Performance Guarantee SAVINGS GUARANTEE Trane guarantees that, as a result of Trane’s implementation of the ECM detailed above, the ECM will create a Total Energy Savings of 47,205 kWh (the “Guarantee”), in the twelve-month period following the Commencement Date. TOTAL ENERGY SAVINGS The energy savings shall be computed as specified in this ESP. Utilizing as-built documentation (drawings, startup logs, field measurements), and trend data, Trane will determine Total Energy Savings for the Guarantee Year by updating the energy calculations found in Section 6 of the IGA Report dated November 28, 2023. CONSTRUCTION/INTERIM PERIOD SAVINGS Energy savings accrued prior to the Commencement Date accrue for the sole benefit of the owner. COMMENCEMENT DATE AND GUARANTEE TERM The "Commencement Date” shall be the first calendar day of the month following the month in which the Date of Notice of Commencement of Energy Savings occurs. This Guarantee shall begin as of the Commencement Date and, unless this Agreement shall terminate earlier, shall expire either on the day immediately preceding the one-year anniversary of the Commencement Date (hereinafter the “Guarantee Term”), or the day the measurement and verification report has been submitted to the DES and client agency, whichever happens later. BASE UTILITY RATES The Base Utility Rates are those utility rates used in the Utility Baseline Analysis that are used to calculate the energy savings, and is the “District Wide” rate as set forth in Table 4.3 of this proposal. The Base Utility Rates used to calculate energy savings will be used as the floor price for the Guarantee Term and shall be the lowest rate used. ADJUSTMENTS Trane may make adjustments to the Baseline at its discretion and with the approval of DES and the Owner using standard and sound engineering principles to account for: a. Process/Building Changes (remodeling, addition of equipment, or change in usage or process): Customer agrees to contact Trane within fifteen (15) calendar days of commencement of any changes or additions of equipment or environments; and b. Data or other information newly discovered or otherwise not readily available at the time the Baseline was prepared; and/or c. Failure of Owner to perform its obligations outlined in this Section of the ESP. Should the owner fail to meet these obligations and depending upon the severity of failure as agreed upon by Trane and DES, the baseline may be adjusted, or the guaranteed energy savings deemed void. OWNER RESPONSIBILITIES Owner acknowledges that they have an integral role in achieving savings and agrees to perform the following responsibilities: December 5, 2023 H - 88 18 a. Properly maintain, repair, and replace all energy consuming equipment with equipment of equal or better energy and operational efficiencies and promptly notify Trane of the repair and /or replacement, but no later than within fourteen (14) calendar days from the commencement thereof; b. Make available to Trane upon its request copies of maintenance records and procedures regarding maintenance of the Premises; c. Promptly provide Trane with notice of system and building alterations at the Premises that impact energy consumption, including but not limited to: energy management systems, and heat recovery systems; d. Log any utility meters and the operation of any energy consuming devices or equipment as directed by Trane and furnish copies of such logs to Trane within thirty (30) calendar days after preparation of the logs; e. Provide to Trane true, accurate and complete descriptions of all energy consuming devices within fifteen (15) days after installation and startup of such equipment. The parties stipulate that, in each event that Owner fails to provide this information within thirty (30) days after the startup of such equipment, Customer shall be deemed to have realized that portion of the Total Energy Savings prorated for the utility billing period to which said energy related bill relates and for such subsequent utility billing periods as are affected by an increase in energy and/or demand use that could have been avoided had Trane been provided with the energy related information in a timely manner. In the event Trane subsequently receives or obtains the untimely energy related bill and such bill discloses that savings were achieved in an amount greater than had been stipulated hereunder, such greater savings will be used in calculating Actual Savings; f. Furnish to Trane true, accurate and complete copies of any utility rate schedules or tariffs promptly upon Trane’s request for the same and, in any event, within thirty (30) calendar days after Customer’s receipt of notice of a utility rate change; g. Maintain in effect and fully perform its obligations under the Maintenance Agreement throughout the duration of the Guarantee; and h. Provide access to trend data as outlined in this Section of the ESP EXCLUSIONS FROM TRANE’S RESPONSIBILITIES Unless caused by Trane or its subcontractors, Trane shall not be responsible for any of the following: a. Any shortfalls in Total Energy Savings or Operational Savings, failure to satisfy the Guarantee, or for loss, damage or malfunction to equipment, systems, controls or building(s) structures resulting from non-Trane personnel or its subcontractors examining, adjusting or repairing equipment, systems, or controls; b. Any damage or malfunction resulting from freezing, corrosion or erosion on the water side of the equipment or caused by scale or sludge on equipment; c. Problems or damages caused by utility service or damage sustained by equipment or systems; d. Outside of those items expressly written in the guarantee language and measurement and verification plan, Trane is not responsible for furnishing any equipment, materials, labor, or performing tests required by insurance companies, or federal, state, or local governments.; and e. Failure or inadequacy of any structure or foundation supporting or surrounding equipment or work or any portion thereof. December 5, 2023 H - 89 19 Measurement and Verification (M&V) Plan Trane’s measurement and verification (M&V) approach for this project is as follows: ECM-3. Senior Center: Install solar array and battery storage IPMVP Method A AGREED UPON PARAMETERS Refer to Table 4.4, Measurement and Verification (M&V) Action Plan Outline in this section of the ESP and Section 6 of the IGA Report for a full listing of agreed upon parameters. APPLICABIILITY This performance guarantee applies to the ECMs listed above in the City of Port Angeles, Washington. EXISTING CONDITIONS Based on site visits, trend collection, review of record documents, interviews with owner staff, and engineering calculations the existing conditions have been defined in the ‘Measurement and Verification (M&V) Action Plan Outline’ in this section of the ESP and scope of work narrative and preliminary design drawings in this ESP. PRE-RETROFIT CONSUMPTION DATA Pre-retrofit power consumption data was calculated by Trane during the investment grade audit based on record documents. Refer to Section 6 of the IGA report dated November 28, 2023 for further detail regarding power production estimates and a summary of collected data. PRE-RETROFIT CONSUMPTION DATA AND MEASUREMENT METHODOLOGY A combination of site visits, field measurements, review of record documents, interviews with Owner staff, and engineering calculations were used to determine the baseline values for the variables listed in Table 4.4 of this ESP. POST-RETROFIT CONSUMPTION DATA AND MEASUREMENT METHODOLOGY A combination of trends to be collected via the inverter and field measurements will be used to determine the post-retrofit values for the variables listed in Table 4.4 of this ESP. December 5, 2023 H - 90 City of Port Angeles Senior Center Solar & Storage TABLE 4.4 - MEASUREMENT AND VERIFICATION (M&V) ACTION PLAN OUTLINE STATUS: Phase 1 - Development ECM NAME FACILITY/ BUILDING KEY PERFORMANCE INDICATORS BASELINE VALUES PROPOSED VALUES INVESTMENT GRADE AUDIT TASKS POST-CONSTRUCTION (Cx) TASKS ANNUAL M&V TASKS YEAR 1 ONGOING OWNER RESPONSIBILITIES STIPULATED VARIABLES ECM 3 Senior Center: Solar & Battery Electric Storage Senior Center 1. Solar Production (kWh / year)0 47,205 Determine suitability of roof for attaching solar array Verify quantity and type of modules installed match or exceed the efficiency of the proposed equipment. Ensure that solar array is producing electricity and interconnected with grid Using trend data from the inverter, verify that the solar array has produced the amount of electricity equal or greater than what was guaranteed. Maintain equipment according to manufacturer recommendations.NA December 5, 2023 H - 91 21 5 Diverse Business Enterprise Utilization Trane’s Diverse Business Outreach Plan includes all Diverse Business, HUBZONE Business, Diverse Disadvantaged Business, Minority Business Enterprise, Women Business Enterprise, Veteran-Owned Businesses, Small Business Enterprise, and Service Disabled Veteran-Owned Diverse Businesses, (SB, HUBZone, SDB, MBE, WBE, VOSB, SBE, and SDVOSB). The plan is designed to maximize the participation by these business enterprise contractors and vendors on all Washington State Department of Enterprise Services projects and is in compliance with Part 10.15 of the General Conditions of the MESA. This Diverse Business Outreach Plan complies with WA DES guidelines and incorporates many of Trane’s subcontracting processes already in place. Trane’s Diverse Business Enterprise goals and utilization for this project are listed below. Trane was unable to engage diverse businesses on this project. TABLE 5.1 DIVERSE BUSINESS UTILIZATION INVESTMENT GRADE AUDIT GOAL UTILIZATION MINORITY OWNED BUSINESS 12% 0% WOMAN OWNED BUSINESS 8% 0% VETERAN OWNED BUSINESS 5% 0% SMALL/MINI/MICRO BUSINESS 5% 0% CONSTRUCTION GOAL UTILIZATION MINORITY OWNED BUSINESS 12% 0% WOMAN OWNED BUSINESS 8% 0% VETERAN OWNED BUSINESS 5% 0% SMALL/MINI/MICRO BUSINESS 5% 0% December 5, 2023 H - 92 IGA Report Prepared by: Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 November 28, 2023 City of Port Angeles Senior Center Energy Upgrades Phase 2: Solar & Storage 328 E 7th St Port Angeles, WA 98362 DES Audit Agreement # 23-227 c/o Department of Enterprise Services 1500 Jefferson Street SE PO Box 41012 Olympia, WA 98504-1012 Website: www.des.wa.gov December 5, 2023 H - 93 1 CONTACTS Site Contact The following facility personnel assisted with this report: Corey Delikat Director of Parks & Recreation City of Port Angeles 308 East 4th Street Port Angeles, WA 98362 Direct: (360) 417-4551 Email: Cdelikat@cityofpa.us Department of Enterprise Services Contact The DES Project Manager (PM) is: Novella Randall Project Manager Washington State Department of Enterprise Services 1500 Jefferson Street Southeast Olympia, Washington 98501 Phone: 360-790-3667 E-mail: novella.randall@des.wa.gov Utility Contact Gregg King Power Resources Manager 321 E 5th St Port Angeles, WA 98362 Phone: 360-417-4710 E-mail: gking@cityofpa.us ESCO Contact Information The Energy Savings Company (ESCO) that prepared this report are: Greg Stinson Trane PNW-RM Region 2333 158th Ct NE Bellevue, WA 98008 Phone: (425) 256-1717 E-mail: Greg.Stinson@tranetechnologies.com December 5, 2023 H - 94 2 Table of Contents 1 General Description ............................................................................................................. 3 2 Facility Description ............................................................................................................... 4 3 ECMs Considered But Not Proposed ................................................................................... 5 4 Infrastructure and O&M Recommendations ......................................................................... 6 5 Utility Data ........................................................................................................................... 7 6 Energy Savings Calculations & Pre-Retrofit Measurements ................................................. 8 7 Design Documents ............................................................................................................... 9 8 Diverse Business Enterprise Utilization ................................. Error! Bookmark not defined. December 5, 2023 H - 95 3 1 General Description Port Angeles is a City and county seat of Clallam County, Washington, United States. With a population of 19,960 as of the 2020 census, it is the largest city in the county. The population was estimated at 20,134 in 2021. Port Angeles has a warm summer Mediterranean climate. The climate is heavily moderated by the Pacific Ocean, resulting in cool summers and mild winters for its latitude. Summers are far cooler than those of nearby Seattle, though on June 27, 2021, Port Angeles set a new all-time record high of 97 °F (36 °C), breaking the city's previous all-time record high of 96 °F (36 °C). https://en.wikipedia.org/wiki/Port_Angeles,_Washington The City published a climate resiliency plan in June 2022. The plan will assist the City in directing measurable action to support system-wide waste and energy/water use reductions, sustainable land use, transportation and economic development, and social and environmental health and equity that celebrates the community’s diversity. The plan shifts the City’s focus by recognizing the importance of contributing to sustainability through public projects that connect trails and transit, commercial development that provides jobs and services to neighborhoods, and innovative Low Impact Development stormwater and building practices. The policies driving the City's future are informed by actions that have been identified as necessary steps to build community-wide climate resilience. https://www.cityofpa.us/1010/Climate-Resiliency-Plan https://www.cityofpa.us/DocumentCenter/View/11771/2022-Climate-Resiliency-Plan---Final The City government operates three main buildings, the Senior Center, Fire Station, and City Hall. There is no gas service to the buildings, electric is the only energy utility. December 5, 2023 H - 96 4 2 Facility Description Senior Center The Port Angeles Senior Community Center is located at 328 E 7th St, Port Angeles, WA 98362. It is a 16,000 square foot building that was completed in 1995 and is cooperatively run by the City of Port Angeles and the Senior Center Board of Directors. This multi-purpose facility offers a complete commercial kitchen, multi-purpose room, dining room, separate coffee lounge, computer room, meeting rooms, a crafts and activities room, game room, and poolroom. All programs and services are self-supporting, and the costs vary accordingly. The building’s operating hours are from 8 am – 5 pm Monday – Friday. The facility is closed on weekends and holidays. The building’s HVAC system is comprised of four (4) outdoor heat pumps installed with the original building. The outdoor compressors are connected separately to four (4) indoor air handling units. The air handling units have constant volume fans that are each connected to separate ducts that each serve different quadrants of the building on multiple floors. There are electric heaters in two of the ducts to provide supplemental heat. There are twenty-two (22) variable air volume (VAV) dampers located in the ducts to control airflow to individual zones. Each air handler has a bypass damper connecting its return and supply air. There are two return fans to draw return air back into the attic mechanical room. There is a grease fan that draws air out of the kitchen through a hood located above the stove tops. When the kitchen vent is not operating, a building relief fan located in the attic removes excess air from the building. Two of the four outdoor heat pumps are no longer operational and have been scavenged for parts to keep the other two heat pumps running. The mission of the Port Angeles Senior Center Board of Directors is to develop and manage programs to encourage physical, intellectual, emotional, and social well-being for citizens 45 and above in a safe and open environment. http://www.portangelesseniorcenter.com/mission.php December 5, 2023 H - 97 5 3 ECMs Considered But Not Proposed ECM-1 proposed installing a new HVAC system in the Senior Center. The project was split into a separate ESP to make it easier to track grant funds and tax. ECM-2 proposed installing three (3) new HVAC rooftop units on the Fire Station. The project was postponed to fit into the City’s budget planning and will be completed as part of a separate contract. ECM-4 proposed installing a solar array on the roof of the Fire Station along with a new battery to back up the power in case of an outage. The project is on a waiting list to receive a state grant and will be completed as part of a separate contract. December 5, 2023 H - 98 6 4 Infrastructure and O&M Recommendations Refer to Section 3, ECMs Considered But Not Proposed, for other potential energy conservation measures to be implemented. December 5, 2023 H - 99 7 5 Utility Data Tables 5.1 and 5.2 shows the historical energy usage for the Senior Center and Fire Station. The average EUI for the past 4 years in the Senior Center is 6% more than typical for social meeting halls in the Energy Star benchmarking survey, while the Fire Station EUI is 25% below. Month Electric Use (kWh) Electric Demand (kW) 2019 2020 2021 2022 Average 2019 2020 2021 2022 Average Jan 29,360 39,400 38,120 52,280 34,380 122 132 133 133 132 Feb 47,600 34,320 34,600 30,560 40,960 151 146 136 119 146 Mar 35,240 34,680 29,480 36,720 34,960 154 147 124 130 147 Apr 24,280 29,000 35,160 27,760 26,640 128 122 118 111 122 May 21,560 18,600 15,240 20,920 20,080 96 104 118 89 104 Jun 22,800 15,880 16,400 20,680 19,340 75 69 79 65 72 Jul 21,560 16,640 15,320 16,120 19,100 77 62 66 63 70 Aug 21,360 12,320 13,840 23,720 16,840 78 52 72 72 65 Sep 18,840 16,560 15,680 15,000 17,700 73 70 54 59 71 Oct 21,680 17,120 20,240 15,520 19,400 100 102 83 78 101 Nov 30,760 30,200 21,880 34,200 30,480 106 114 90 112 110 Dec 28,040 34,280 29,000 31,160 118 124 88 121 Total 323,080 299,000 284,960 293,480 311,040 1,280 1,243 1,159 1,030 1,261 Tot (kBtu) 1,102,349 1,020,188 972,284 1,001,354 1,061,268 126,090 Total Energy Use in kBtu 1,061,268 Energy Use Index (kBtu/sqft/yr) 57.6 TABLE 5.1: HISTORICAL SENIOR CENTER ENERGY USE December 5, 2023 H - 100 8 6 Energy Savings Calculations & Pre- Retrofit Measurements Trane analyzed four years of utility bills for the Senior Center. Trane received a solar production model from the solar contractor, A&R Solar. The model shows that the solar array mounted on the roof of the Senior Center produces 1,049 kWh/year for each kW of solar installed. Installing 50 kW should result in 52,450 kWh of solar produced, which is summarized in Table 6.1. Energy Conservation Measure (ECM) Baseline (KWh/yr) Proposed (KWh/yr) Calculated Electric Savings (100%) Guaranteed Electric Savings (90%) ECM 3. Install Solar and Batteries at Senior Center 311,040 258,590 52,450 47,205 TABLE 6.1 SUMMARY OF SAVINGS FROM ECM Trane guarantees 90% of that production. Table 6.2 summarizes the electric savings the Senior Center HVAC upgrade will provide based on the solar production. Year Electricity (kWh) Total (MMBtu) Electricity Cost ($) Measured Values 311,040 1,061 $18,662 ECM-1 258,590 882 $15,515 Savings 52,450 179 $3,147 TABLE 6.2: SUMMARY OF ELECTRICITY AND UTILITY COST SAVINGS FOR ECM-3 December 5, 2023 H - 101 9 7 Design Documents December 5, 2023 H - 102 (N) (118) HANWHA 425W MODULESMAIN ELECTRICAL ROOM ON GROUND FLOOR(E) 1200A 208V 3-PHASE MAIN SWITCHBOARD(E) SERVICE METER (CITY OF PORT ANGELES)(E) POLE MOUNTED TRANSFORMERS(E) STORAGE ROOM ADJOININGMAIN ELECTRICAL ROOM( N) ISOLATION TRANSFORMER ON CONCRETE PAD( N) BESS CONTAINER ON CONCRETE PAD CONDUIT IN TRENCH CONDUIT ON ROOFTOP(N) PROPOSED NEWDUMPSTER LOCATION1SITE OVERVIEWScale: 1" : 30'-0" N 328 EAST 7TH STREETPORT ANGELES, WA 98362PORT ANGELES SENIOR CENTERPV SYSTEM 50 kW AC, 50.22 kW DCSTORAGE SYSTEM 200 kWh AC, 50 kW ACA1 SITE OVERVIEWTHIS DRAWING CONSTITUTES THE CONFFIDENTIAL INFORMATION OF A&R SOLAR AND ITS RECEPTOR POSSESSION DOES NOT CONFER ANY RIGHT IN OR LICENSE TO USE IT OR THE INFORMATTION DISCLOSED HERE IN NOR ANY RIGHT TO REPRODUCE THIS DRAWING OR ANY PART HERE IN WITHOUT THE WRITTEN CONSENT OF A&R SOLAR.REVISIONSDESIGNED: J LYONS 3211 Martin Luther King Jr Way S.Seattle, WA 98144 (206)707-9937Rev. #:Date: Oct 28, 2023 0PM: TBDCELL: (XXX) XXX-XXXXPRELIMINARYDecember 5, 2023H - 103 1A3.12A3.1A3.11A3.1A3.12A3.1(N) PV AC PANELBOARD (SPLITTER)(N) SOLAREDGE 50kW PV INVERTER(N) PV AC DISCONNECT(E) MAIN SWITCHBOARD1200A 208V 3-PHASE (N) CRITICAL LOADS AC PANELBOARD (COMBINER)(N) CRITICAL LOADS MANUAL TRANSFER SWITCH(N) BESS AC DISCONNECT(N) CRITICAL LOADS AC PANELBOARD (SPLITTER)(N) 75KVA ISOLATION TRANSFORMER (PAD MOUNTED)(N) ESP BATTERY RACK, TYP (1 OF 4)(N) SOL-ARK 30kW INVERTER 2(N) SOL-ARK 30kW INVERTER 1(N) SOL-ARK AC PANELBOARD (COMBINER)(N) BESS CONTAINER ENCLOSURE (PAD MOUNTED)A3.1ENLARGED PLANSN ENLARGED PLANSBESS PAD & XFMR PADScale: 1/4" : 1'-0" MAIN ELECTRICAL ROOM &STORAGE ROOMScale: 1/4" : 1'-0" 328 EAST 7TH STREETPORT ANGELES, WA 98362PORT ANGELES SENIOR CENTERPV SYSTEM 50 kW AC, 50.22 kW DCSTORAGE SYSTEM 200 kWh AC, 50 kW ACA3.1 ENLARGED PLANSTHIS DRAWING CONSTITUTES THE CONFFIDENTIAL INFORMATION OF A&R SOLAR AND ITS RECEPTOR POSSESSION DOES NOT CONFER ANY RIGHT IN OR LICENSE TO USE IT OR THE INFORMATTION DISCLOSED HERE IN NOR ANY RIGHT TO REPRODUCE THIS DRAWING OR ANY PART HERE IN WITHOUT THE WRITTEN CONSENT OF A&R SOLAR.REVISIONSDESIGNED: J LYONS 3211 Martin Luther King Jr Way S.Seattle, WA 98144 (206)707-9937Rev. #:Date: Oct 28, 2023 0PM: TBDCELL: (XXX) XXX-XXXXPRELIMINARYDecember 5, 2023H - 104 PV modules1+/-621211PV modules+/-BatteryBattery735(E) 1200A 208V 3-Phase Main Switchboard1310} Backup Loads(E) Panel F984Electrical Schedule/ BOMRef. Category EquipmentQTY1 Modules Q Cell 425W1182 Rapid Shutdown SolarEdge Optimizers1183 PV Inverter SolarEdge SE50KUS 50kW 208V 3-phase14 AC Disconnect PV AC disconnect15 AC Panelboard PV AC panelboard (splitter)16 Battery Inverter Sol-Ark 30kW 208V 3-phase27 AC Panelboard Sol-Ark AC panelboard (combiner)18 AC Disconnect BESS AC disconnect19 Transfer Switch Critical loads manual transfer switch110 AC Panelboard Critical loads AC panelboard (combiner)111 AC Panelboard Critical loads AC panelboard (splitter)112 BatteryESP-5K HL LFP Battery4013 DC Combiner DC combiner panel 2+/-~DC DisconnectETHERNET INTERNET CONNECTION+/-Battery~+/-PV~+/-Battery~+/-PV~= A & R Scope= Existing or Others ScopeCELLULAR CONNECTION TO BEAT INVERTER(S)LOCATION FOR MONITORING &SYSTEM MAINTENANCEEquipmentScheduleAC Genset AC Backup Loads Automatic Transfer Switch& Protective RelayAC BusMicrogrid Controller50A50A83.4A4 MPPTs8 strings36A/MPPT83.4A83.4AAC Genset AC Backup Loads Automatic Transfer Switch& Protective RelayAC BusMicrogrid Controller50A50A83.4A4 MPPTs8 strings36A/MPPT83.4A83.4A1SINGLE LINENTS328 EAST 7TH STREETPORT ANGELES, WA 98362PORT ANGELES SENIOR CENTERPV SYSTEM 50 kW AC, 50.22 kW DCSTORAGE SYSTEM 200 kWh AC, 50 kW ACE1 SINGLE LINETHIS DRAWING CONSTITUTES THE CONFFIDENTIAL INFORMATION OF A&R SOLAR AND ITS RECEPTOR POSSESSION DOES NOT CONFER ANY RIGHT IN OR LICENSE TO USE IT OR THE INFORMATTION DISCLOSED HERE IN NOR ANY RIGHT TO REPRODUCE THIS DRAWING OR ANY PART HERE IN WITHOUT THE WRITTEN CONSENT OF A&R SOLAR.REVISIONSDESIGNED: J LYONS 3211 Martin Luther King Jr Way S.Seattle, WA 98144 (206)707-9937Rev. #:Date: Oct 28, 2023 0PM: TBDCELL: (XXX) XXX-XXXXPRELIMINARYDecember 5, 2023H - 105 Aurora Shade Report Customer Shane Nesbitt Designer A&R Solar Organization 328 E 7th St Port Angeles, WA 98362, USA Address (48.111563, -123.433737) Coordinates 21 March 2023 Date Annual irradiance 2,450 or more 2,100 1,750 1,400 1,050 700 350 0 kWh/m /year2 Array Panel Count Azimuth (deg.)Pitch (deg.)Annual TOF (%)Annual Solar Access (%)Annual TSRF (%) 1 53 211 30 97 99 96 2 13 302 27 73 98 72 3 15 301 27 73 97 71 4 7 302 26 72 97 70 5 16 121 27 92 98 90 6 6 122 26 92 96 89 Weighted average by panel count ----98.1 86.7 Summary 1/4 December 5, 2023 H - 106 Customer Shane Nesbitt Designer A&R Solar Organization 328 E 7th St Port Angeles, WA 98362, USA Address (48.111563, -123.433737) Coordinates 21 March 2023 Date Array Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 1 97 99 98 99 99 99 99 99 99 99 98 98 2 95 97 96 98 98 98 99 98 98 97 96 96 3 83 88 97 99 99 99 99 99 98 94 88 89 4 94 96 95 97 97 97 97 98 97 96 95 94 5 93 97 98 99 99 99 99 99 99 98 95 91 6 95 96 96 96 96 96 96 97 97 97 96 95 Monthly solar access (%) across arrays 2/4 December 5, 2023 H - 107 Customer Shane Nesbitt Designer A&R Solar Organization 328 E 7th St Port Angeles, WA 98362, USA Address (48.111563, -123.433737) Coordinates 21 March 2023 Date Zoomed out satellite view 47 ft 3D model 3D model with LIDAR overlay 3/4 December 5, 2023 H - 108 Customer Shane Nesbitt Designer A&R Solar Organization 328 E 7th St Port Angeles, WA 98362, USA Address (48.111563, -123.433737) Coordinates 21 March 2023 Date Street view and corresponding 3D model I, Shane Nesbitt, certify that I have generated this shading report to the best of my abilities, and I believe its contents to be accurate. 4/4 328 E 7th St Port Angeles, Washington © 2023 Google December 5, 2023 H - 109 December 5, 2023 H - 110 TOP BRAND PV MODULES USA 2022 Q.TRON BLK M-G2+MODEL 415-440Wp | 108Cells 22.5% Maximum Module Eciency Q.TRON BLK M-G2+ SERIES The ideal solution for: Rooftop arrays on residential buildings See data sheet on rear for further information. APT test conditions according to IEC/T S 62804-1:2015, method A (-1500V, 96h) Qcells is the first solar module manufacturer to pass the most comprehensive quality programme in the industry: The new “Quality Controlled PV” of the independent certification institute TÜV Rheinland. The most thorough testing programme in the industry Q.ANTUM NEO Technology with optimized module layout boosts module eciency up to 22.5%. High performance Qcells N-type solar cells Innovative all-weather technology Optimal yields, whatever the weather with excellent low-light and temperature behaviour. High-tech aluminium alloy frame, certified for high snow (8100P a) and wind loads (3600Pa). Extreme weather rating Long-term yield security with Anti LeTID Technology, Anti PID Technology2, Hot-Spot Protect. Enduring high performance Inclusive 25-year product warranty and 25-year linear performance warranty1. A reliable investment December 5, 2023 H - 111 NA DETAIL A 0.63" (16 mm) 0.33" (8.5 mm)0.97" (24.55 mm) 38.6" (980 mm) 67.8" (1722 mm) 4 × Mounting slots (DETAIL A) Frame 44.6" (1134 mm) 42.7" (1085 mm) 1.18" (30 mm) 8 × Drainage holes 14.6“ (371 mm) 4 × Grounding points ø 0.18" (4.5 mm) Label ≥68.9" (1750mm) ≥68.9" (1750mm) Format 67.8 in × 44.6 in × 1.18 in (including frame) (1722mm × 1134mm × 30mm) Weight 46.7lbs (21.2kg) Front Cover 0.13 in (3.2mm) thermally pre-stressed glass with anti-reflection technology Back Cover Composite film Frame Black anodised aluminium Cell 6 × 18 monocrystalline Q.ANTUM NEO solar half cells Junction box 2.09-3.98in × 1.26-2.36in× 0.59-0.71in (53-101mm × 32-60mm × 15-18mm), Protection class IP67, with bypass diodes Cable 4mm Solar cable; (+) 68.9in (1750mm), (-) 68.9in (1750mm) Connector Stäubli MC4; IP68 Mechanical Specification Qcells pursues minimizing paper output in consideration of the global environment. Note: Installation instructions must be followed. Contact our technical service for further information on approved installation of this product. Hanwha Q CELLS America Inc. 400 Spectrum Center Drive, Suite 1400, Irvine, CA 92618, USA | TEL +1 949 748 59 96 | EMAIL hqc-inquiry@qcells.com | WEB www.qcells.com Q.TRON BLK M-G2+ SERIES 415 420 425 430 435 440 [W]415 420 425 430 435 440 [A]13.49 13.58 13.66 13.74 13.82 13.90 [V]38.47 38.75 39.03 39.32 39.60 39.88 [A]12.83 12.91 12.98 13.05 13.13 13.20 [V]32.34 32.54 32.74 32.94 33.14 33.33 [%] 21.3 21.5 21.8 22.0 22.3 22.5 [W]313.7 317.5 321.2 325.0 328.8 332.6 [A] 10.87 10.94 11.00 11.07 11.14 11.20 [V] 36.50 36.77 37.04 37.31 37.58 37.84 [A] 10.10 10.15 10.21 10.27 10.33 10.38 [V] 31.07 31.26 31.46 31.65 31.84 32.03 Specifications subject to technical changes © Qcells Q.TRON_BLK_M-G2+_series_415-440_2023-09_Rev01_NAQuality Controlled PV - TÜV Rheinland; IEC 61215:2016; IEC 61730:2016. This data sheet complies with DIN EN 50380. Qualifications and Certificates 200 400 600 800 1000 90 100 80 110 10 2515 200 05 90.58 98.5 95 80 100 85 Electrical Characteristics POWER CLASS MINIMUM PERFORMANCE AT STANDARD TEST CONDITIONS, STC POWER TOLERANCE +5W/-0W MinimumPower at MPP1 PMPP Short Circuit Current1 ISC Open Circuit Voltage1 VOC Current at MPP IMPP Voltage at MPP VMPP Eciency 1 MINIMUM PERFORMANCE AT NORMAL OPERATING CONDITIONS, NMOT MinimumPower at MPP PMPP Short Circuit Current ISC Open Circuit Voltage VOC Current at MPP IMPP Voltage at MPP VMPP Measurement tolerances P MPP ±3%; I SC; VOC ±5% at STC: 1000W/m, 25±2°C, AM 1.5 according to IEC 60904-3 • 800W/m, NMOT, spectrum AM 1.5 Qcells PERFORMANCE WARRANTY PERFORMANCE AT LOW IRRADIANCE At least 98.5% of nominal power during first year. Thereafter max. 0.33% degradation per year. At least 95.53% of nominal power up to 10 years. At least 90.58% of nominal power up to 25years. All data within measurement tolerances. Full warranties in accordance with the warranty terms of the Qcells sales organisation of your respective country. Typical module performance under low irradiance conditions in comparison to STC conditions (25°C, 1000W/m 2). YEARS IRRADIANCE [W/m²] Qcells Industry standard of p-mono* *Standard terms of guarantee for the 5 PV companies with the highest production capacity in 2021 (February 2021)RELATIVE EFFCIENCY [%]RELATIVE EFFCIENCYCOMPARED TO NOMINAL POWER [%]Properties for System Design Maximum System Voltage VSYS [V]1000 (IEC)/1000 (UL)PV module classification Class II Maximum Series Fuse Rating [A DC]25 Fire Rating based on ANSI/UL 61730 C / TYPE 2 Max. Design Load, Push/Pull 3 [lbs/ft 2] 113 (5400Pa)/50 (2400Pa)Permitted Module Temperature on Continuous Duty -40°F up to +185°F (-40°C up to +85°C)Max. Test Load, Push/Pull 3 [lbs/ft 2]169 (8100Pa)/75 (3600Pa) 3 See Installation Manual TEMPERATURE COEFFICIENTS Temperature Coecient of I SC [%/K] +0.04 Temperature Coecient of V OC [%/K] -0.24 Temperature Coecient of P MPP [%/K] -0.30 Nominal Module Operating Temperature NMOT [°F]109±5.4 (43 ±3°C) *UL and California Energy Commission (CEC) listings pending December 5, 2023 H - 112 Three Phase Inverter with Synergy Technology For the 208V Grid for North America SE50KUS Powered by unique pre-commissioning process for rapid system installation Pre-commissioning feature for automated validation of system components and wiring during the site installation process and prior to grid connection Easy 2-person installation with lightweight, modular design (each inverter consists of 2 or 3 Synergy units and one Synergy Manager) Independent operation of each Synergy unit enables higher uptime and easy serviceability Built-in thermal sensors detect faulty wiring ensuring enhanced protection and safety Built-in arc fault protection and optional rapid shutdown Built-in PID mitigation for maximized system performance Monitored* and field-replaceable surge protection devices, to better withstand surges caused by lightning or other events Built-in module-level monitoring with Ethernet or cellular communication for full system visibility *Applicable only for DC and AC SPDs solaredge.com INVERTERS12-20 YEAR WARRANTY December 5, 2023 H - 113 Three Phase Inverter with Synergy Technology For the 208V Grid for North America SE50KUS Applicable to inverter with Part Numbers SExxK-USx2Ixxxx SE50KUS OUTPUT Rated AC Active Output Power 50000 W Maximum AC Apparent Output Power 50000 VA AC Output Line Connections 3W + PE, 4W + PE Supported Grids WYE: TN-C, TN-S, TN-C-S, TT, IT; Delta: IT AC Output Voltage Minimum-Nominal-Maximum(1) (L-N) 105-120-132.5 Vac AC Output Voltage Minimum-Nominal-Maximum(1) (L-L) 183-208-229 Vac AC Frequency Min-Nom-Max(1) 59.5 - 60 - 60.5 Hz Maximum Continuous Output Current (per Phase, PF=1) 139.5 Aac GFDI Threshold 1 A Utility Monitoring, Islanding Protection, Configurable Power Factor, Country Configurable Thresholds Yes Total Harmonic Distortion ≤ 3 % Power Factor Range +/-0.2 to 1 INPUT Maximum DC Power (Module STC) Inverter / Synergy Unit 139.5 W Transformer-less, Ungrounded Yes Maximum Input Voltage DC+ to DC- 600 Vdc Operating Voltage Range 370 - 600 Vdc Maximum Input Current 3 x 46.5 Adc Reverse-Polarity Protection Yes Ground-Fault Isolation Detection 167kΩ sensitivity per Synergy Unit(2) CEC Weighted Efficiency 97 % Nighttime Power Consumption < 12 W ADDITIONAL FEATURES Supported Communication Interfaces(3) 2 x RS485, Ethernet, Wi-Fi (optional), Cellular (optional) Smart Energy Management Export Limitation Inverter Commissioning With the SetApp mobile application using built-in Wi-Fi access point for local connection Arc Fault Protection Built-in, User Configurable (According to UL1699B) Photovoltaic Rapid Shutdown System NEC 2014, 2017 and 2020, Built-in PID Rectifier Nighttime, built-in RS485 Surge Protection (ports 1+2) Type II, field replaceable, integrated AC, DC Surge Protection Type II, field replaceable, integrated DC Fuses (Single Pole) 25A, integrated DC SAFETY SWITCH DC Disconnect Built-in STANDARD COMPLIANCE Safety UL1699B, CSA C22.2#107.1, Canadian AFCI according to T.I.L. M-07 Grid Connection Standards IEEE 1547, Rule 21, Rule 14 (HI) Emissions FCC part 15 class A (1) For other regional settings please contact SolarEdge support(2) Where permitted by local regulations (3) For specifications of the optional communication options, visit https://www.solaredge.com/products/communication or the Resource Library webpage: https://www.solaredge.com/downloads#, to download the relevant product datasheet December 5, 2023 H - 114 Three Phase Inverter with Synergy Technology For the 208V Grid for North America SE50KUS Applicable to inverter with Part Numbers SExxK-USx2Ixxxx SE50KUS INSTALLATION SPECIFICATIONS Number of Synergy Units per Inverter 3 AC Max Conduit Size 2 ½" in Max AWG Line / PE 4/0 / 1/0 DC Max Conduit Size 1 x 3” ; 2 x 2" in DC Input Inverter / Synergy Unit(4)12 / 4 pairs; 6-12 AWG Dimensions (H x W x D) Synergy Unit: 22 x 12.9 x 10.75 / 558 x 328 x 273 Synergy Manager: 14.17 x 22.4 x 11.6 / 360 x 560 x 295 in / mm Weight Synergy Unit: 70.4 / 32 Synergy Manager: 39.6 / 18 lb / kg Operating Temperature Range -40 to +140 / -40 to +60(5)̊F / ˚C Cooling Fan (user replaceable) Noise < 67 dBA Protection Rating NEMA 3R Mounting Brackets provided (4)DC input is also available with single pair termination per synergy unit. For more information contact SolarEdge (5)For power de-rating information refer to: https://www.solaredge.com/sites/default/files/se-temperature-derating-note.pdf © SolarEdge Technologies, Ltd. All rights reserved. SOLAREDGE, the SolarEdge logo, OPTIMIZED BY SOLAREDGE are trademarks or registered trademarks of SolarEdge Technologies, Inc. All other trademarks mentioned herein are trademarks of their respective owners.Date:06/2021 DS-000037-1.1-NA.Subject to change without notice. December 5, 2023 H - 115 Sense the Difference.Live the Power. Rack SolutionESP-R12-E Storage ProductUp to 65 kWh Battery Packs with BMS Model Dimensions (H x W x D) Weight Equipment Mounting Capacity Material Color and nish Protection Level Warranty Compliance ESP-R12-E 80.2 x 29.7 x 26 inches (2037 x 755 x 660mm) 324 lb (147 kg) 12 ESP-5K HL and 1 ESP-BCU HL / 13 ESP-5K HL Steel Gray or White / Powder Coated Intended for Indoor Use Only 10-Year UL9540, UL1973, CEC and SGIP pending 4 100 Ah 192 V - 224 V 20 kWh 729.9 lb 331 kg 2 100 Ah 96 V - 112 V 10 kWh 527 lb 239 kg Congurations Battery Packs In Series Storage Capacity Working Voltage Nominal Energy Weight (lb) Weight (kg) 1 100 Ah 48 V - 56 V 5 kWh 425.6 lb 193 kg 3 100 Ah 144 V - 168 V 15 kWh 628.4 lb 285 kg 5 100 Ah 240 V - 280 V 25 kWh 831.3 lb 377 kg 6 100 Ah 288 V - 336 V 30 kWh 932.7 lb 423 kg 7 100 Ah 336 V - 392 V 35 kWh 1034.1 lb 469 kg 11 100 Ah 528 V - 616 V 55 kWh 1439.9 lb 653 kg 9 100 Ah 432 V - 504 V 45 kWh 1237 lb 561 kg Congurations Battery Packs In Series Storage Capacity Working Voltage Nominal Energy Weight (lb) Weight (kg) 8 100 Ah 384 V - 448 V 40 kWh 1135.6 lb 515 kg 10 100 Ah 480 V - 560 V 50 kWh 1338.4 lb 607 kg 12 100 Ah 576 V - 672 V 60 kWh 1541.3 lb 699 kg 13 100 Ah 624 V - 728V 65 kWh 1642.7 lb 745 kg 2 EndurEnergy Systems, Inc. EndurEnergy Systems, Inc.©2023 EndurEnergy Systems, Inc. All rights reserved. All specifications are subject to change without notice.1-888-E²-ENDUR (323-6387) • endurenergy.com • sales@endurenergy.com • support@endurenergy.com OUTLAST. OUTPERFORM. ENDUR™ IT ALL. Rev. A 09/07/23 December 5, 2023 H - 116 2 EndurEnergy Systems, Inc. EndurEnergy Systems, Inc.©2023 EndurEnergy Systems, Inc. All rights reserved. All specifications are subject to change without notice.1-888-E²-ENDUR (323-6387) • endurenergy.com • sales@endurenergy.com • support@endurenergy.com OUTLAST. OUTPERFORM. ENDUR™ IT ALL. Rev. A 09/07/23 4 400 Ah 48 V - 56 V 20 kWh 729.9 lb 331 kg 2 200 Ah 48 V - 56 V 10 kWh 527 lb 239 kg Congurations Battery Packs In Parallel Storage Capacity Working Voltage Nominal Energy Weight (lb) Weight (kg) 1 100 Ah 48 V - 56 V 5 kWh 425.6 lb 193 kg 3 300 Ah 48 V - 56 V 15 kWh 628.4 lb 285 kg 5 500 Ah 48 V - 56 V 25 kWh 831.3 lb 377 kg 6 600 Ah 48 V - 56 V 30 kWh 932.7 lb 423 kg 7 700 Ah 48 V - 56 V 35 kWh 1034.1 lb 469 kg 11 1100 Ah 48 V - 56 V 55 kWh 1439.9 lb 653 kg 9 900 Ah 48 V - 56 V 45 kWh 1237 lb 561 kg Congurations Battery Packs In Parallel Storage Capacity Working Voltage Nominal Energy Weight (lb) Weight (kg) 8 800 Ah 48 V - 56 V 40 kWh 1135.6 lb 515 kg 10 1000 Ah 48 V - 56 V 50 kWh 1338.4 lb 607 kg 12 1200 Ah 48 V - 56 V 60 kWh 1541.3 lb 699 kg 13 1300 Ah 48 V - 56 V 65 kWh 1642.7 lb 745 kg Exploded View Twelve-Battery with Control Unit Conguration Front View Twelve-Battery with Control Unit Conguration Mechanical Drawings December 5, 2023 H - 117 Battery PackESP-5K HL Residential, Commercian and Industrial 5 kWh DC Battery 2 EndurEnergy Systems, Inc. EndurEnergy Systems, Inc.©2023 EndurEnergy Systems, Inc. All rights reserved. All specifications are subject to change without notice.1-888-E²-ENDUR (323-6387) • endurenergy.com • sales@endurenergy.com • support@endurenergy.com OUTLAST. OUTPERFORM. ENDUR™ IT ALL. Rev. C 08/30/23 Sense the Difference.Live the Power. Model Nominal Voltage Working Voltage Battery Capacity Nominal Battery Energy Peak Power Max. Battery Bank Size Max. Battery System Capacity Recommended C rate Round Trip Eciency Recommended DoD Charge Temperature Range Discharge Temperature Range Life Cycles Protection Level Size L x W x H Weight Battery Type Warranty Compliance ESP-5K HL 50 V 48 V - 56 V 100 Ah 5 kWh 5 kW 3s 80 kWh per string (16 packs per string) 640 kWh per system (8 strings with 16 packs each) 0.5 C 97% 90% 32 °F to 113 °F (0 °C to 45 °C) 14 °F to 131°F (-10 °C to 55 °C) 6000 IP20 17.40 x 19.70 x 5.24 in (442 x 500 x 133 mm) 101.413 lb (46.00 kg) Lithium Iron Phosphate (LFP) 10-Year UL9540, UL9540A, UL1973, CEC and SGIP pending Fully-Integrated Battery Energy Storage Systems December 5, 2023 H - 118 Cut Sheet v1.0 See Description / Length 1.75 .46 .58 1.00 .62 1.33 1.67 XR10 Rail December 5, 2023 H - 119 The S-5-S clamp was created specifically for popular snap-together profiles. ® ® ®The right way to attach almost anything to metal roofs! S-5-S and S-5-S Mini888-825-3432 | www.S-5.com S-5-S Clamp The S-5-S clamp was created specifically for popular snap-together profiles— including residential profiles by Taylor Metals and Easy Lock Standing Seam. For horizontal seams under .540 inches (like the Firestone UC4) the S-5-S or S-5-S Mini can be used to avoid the necessity of crimping the seam. Its simple design and size make it perfect for use with S-5!® snow retention products and other heavy-duty applications. Installation is as simple as setting the patented round-point setscrews into the clamp, placing the clamp on the seam, and tightening them to the specified tension. Then, affix ancillary items using the bolt provided with the product. Go to www.S-5.com/tools for information and tools available for properly attaching and tensioning S-5! clamps. S-5-S Mini Clamp The S-5-S Mini is a bit shorter than the S-5-S and has one setscrew rather than two. The mini is the choice for attaching all kinds of rooftop accessories: signs, walkways, satellite dishes, antennas, rooftop lighting, lightning protection systems, solar arrays, exhaust stack bracing, conduit, condensate lines, mechanical equipment—just about anything!* *S-5! mini clamps are not compatible with, and should not be used with S-5! SnoRail™/SnoFence™ or ColorGard® snow retention systems. December 5, 2023 H - 120 Please note: All measurements are rounded to the second decimal place. Distributed byS-5!® Warning! Please use this product responsibly! Products are protected by multiple U.S. and foreign patents. Visit the website at www.S-5.com for complete information on patents and trademarks. For maximum holding strength, setscrews should be tensioned and re-tensioned as the seam material compresses. Clamp setscrew tension should be verified using a calibrated torque wrench between 160 and 180 inch pounds when used on 22ga steel, and between 130 and 150 inch pounds for all other metals and thinner gauges of steel. Consult the S-5! website at www.S-5.com for published data regarding holding strength. Copyright 2013, Metal Roof Innovations, Ltd. S-5! products are patent protected. S-5! aggressively protects its patents, trademarks and copyrights. Version 111813. The strength of the S-5-S clamp is in its simple design. The patented setscrews will slightly dimple the metal seam material but not pierce it— leaving roof warranties intact. S-5-S Mini Clamp S-5-S Clamp 2.00" (51.00 mm) 0.50" (12.70 mm) 0.50" (12.70 mm) 1.50" (38.00 mm) Two M10-1.5 Threaded Holes 1.50" (38.00 mm) 0.55" (14.00 mm) M10-1.5 X 16.00 mm Hex Flange Bolt 0.91" (23.00 mm) 1.18" (30.00 mm) 1.50" (38.00 mm) One M8-1.25 Threaded Hole Centered On Part 1.50" (38.00 mm) 0.55" (14.00 mm) M8-1.25 X 16.00 mm Hex Flange Bolt 0.91" (23.00 mm) One 3/8-24 X 0.80" Round Point Setscrews Two 3/8-24 X 0.80" Round Point Setscrews Example Profiles ® The S-5-S and S-5-S Mini clamps are each furnished with the hardware shown to the right. Each box also includes a bit tip for tightening setscrews using an electric screw gun. A structural aluminum attachment clamp, the S-5-S is compatible with most common metal roofing materials excluding copper. All included hardware is stainless steel. Please visit www.S-5.com for more information including CAD details, metallurgical compatibilities and specifications. The S-5-S clamp has been tested for load-to-failure results on most major brands and profiles of standing seam roofing. The independent lab test data found at www.S-5.com can be used for load-critical designs and applications. S-5!® holding strength is unmatched in the industry. Profiles that are shaped as illustrated below will work with the S-5-S and S-5-S Mini. In order for the S-5-S or S-5-S Mini to fit these types of seams, the finished seam must: • Be at least 1.00” high. • Have a height distance less than or equal to 0.25” between the male portion of the panel and female portion of the panel. December 5, 2023 H - 121 Max Allowed PV Power 39,000W Max PV Power Delivered to BaƩery & AC Outputs 30,000W Max DC Voltage (Voc) 500V @ 36A MPPT Voltage Range 170-500V StarƟng Voltage 150V Number of MPPT 4 Max Solar Strings Per MPPT 2 Max DC Current per MPPT (Self LimiƟng) 36A Max AC Coupled Input into GEN termi- nal (Micro / String Inverters) 60kVA w/ no PVDC ** 30kVA w/ 39kW PVDC Solar Input Power 39,000W ConnecƟons 120V / 208V Three Phase ConƟnuous AC Power with PV 30,000W 83.4A (208V) ConƟnuous AC Power from BaƩeries 30,000W 83.4A (208V) TBD Surge AC Power | 7 sec 60,000VA | 167A x120V x 3 Parallel Stacking Yes—Up to 12 Frequency 60/50Hz ConƟnuous AC Power with Grid or Generator 72,000W 200A L-L (208V) ** 36,000W 200A L-N (120V) CEC Efficiency 96.5% (Peak 97.5%) Idle ConsumpƟon Typical—No Load TBD Sell Back Power Modes Limited to Household/Fully Grid-Tied Design (DC to AC) Transformerless DC Response Time (Grid-Tied to Off-Grid) 5ms Power Factor +/- 0.8 - 1.0 AC Output Power 30kW On-Grid & Off-Grid Dimensions (H x W x D) 35.2” x 20.8” x 11.6” Weight 172 lbs Enclosure IP65 / NEMA 3R Ambient Temperature -40~60°C, >45°C DeraƟng InstallaƟon Style Wall-Mounted Wi-Fi & LAN CommunicaƟon Included Standard Warranty (verified by HALT TesƟng) 10 years General Type | Number of Inputs Li-Ion | 2 Inputs Nominal DC Input > 300V Capacity 50 — 9900Ah Voltage Range 150V—550V ConƟnuous BaƩery Charging Output 100A (50A per Input) Charging Curve 3-Stage w/ EqualizaƟon Grid to BaƩ Charging Efficiency 96.0% BaƩery Fuse Integrated Current Shunt for Accurate % SOC Integrated External Gen Start Based on Voltage or %SOC Integrated CommunicaƟon to Lithium BaƩery* CanBus & RS485 BaƩery (opƟonal) Output Power 30,000W Electronics CerƟfied Safety by SGS Labs to NEC & UL Specs - NEC 690.4B & NEC 705.4/6 Pending Grid Sell Back — UL1741-2010/2018, IEE- E1547a-2003/2014, FCC 15 Class B, UL1741SB, CA Rule 21, HECO Rule 14H Pending PV DC Disconnect Switch — NEC 240.15 Integrated Ground Fault DetecƟon — NEC 690.5 Integrated PV Rapid Shutdown Control — NEC 690.12 Integrated PV Arc Fault DetecƟon — NEC 690.11 Integrated PV Input Lightning ProtecƟon Integrated PV String Input Reverse Polarity ProtecƟon Integrated Surge ProtecƟon DC Type II / AC Type II ProtecƟons & CerƟficaƟons 30K-3P-208V-N Spec Sheet ** SoŌware LimitaƟon: 180A x 120V x 3 *ONLY works with Li-BaƩeries under Closed-Loop CommunicaƟons December 5, 2023 H - 122 Date: December 5, 2023 To: City Council From: Calvin W. Goings, Assistant City Manager Sarina Carrizosa, Finance Director Ben Braudrick, Planning Supervisor Subject: 2024 Lodging Tax Advisory Committee Budget Recommendation Background / Analysis: In accordance with the Revised Code of Washington, the Lodging Tax Advisory Committee must provide recommendations to City Council for the use of Lodging Tax funds. The Lodging Tax Advisory Committee (LTAC) met on September 28, 2023, to review the City’s Lodging Tax Fund (LTAX) 2023 expenditures and revenues and the preliminary 2024 budget proposed by staff using the Committee’s established funding priorities. In 2024, the estimated revenue the City anticipates receiving from lodging tax is $876,200. Additionally, during this meeting the LTAC approved an additional use of $47,600 for operations from excess reserves and an additional $212,500 for capital and $25,000 for marketing were also included in the budget per LTAC and Council app roval in 2022. Staff provided a recommended preliminary budget at this funding level as detailed below. 2024 Preliminary Budget for Lodging Tax Fund 5% toward Capital Facilities Reserve (tourism-related reserves to be used at the discretion of the Committee at a future date). $43,800 20% toward Capital Facilities (capital expenditures of tourism-related facilities owned or operated by the City), plus $212,500 previously approved from reserves. $387,700 25% toward Marketing (to support tourism), plus $25,000 previously approved from reserves. $244,100 33% plus $47,600 in reserve funds toward Operations (operations of tourism - related facilities owned or operated by the City or a nonprofit organization) $336,700 Summary: On November 15, 2023, after reviewing applications and receiving public comment, the Lodging Tax Advisory Committee unanimously recommended approval of a final 2024 Lodging Tax (LTAX) Fund budget of $1,071,800. Funding: In 2024, the estimated revenue the City anticipates receiving from lodging tax is $876,200. Utilizing reserve funds, the final recommended budget is $1,071,800. Recommendation: 1) Adopt the Lodging Tax Advisory Committee’s (LTAC) recommended final allocation for the 2024 Lodging Tax Fund budget in the amount of $1,071,800 and 2) authorize the City Manager to implement the LTAC recommendations and make any minor modifications as necessary. December 5, 2023 I - 1 12% toward Events (marketing and operations of special events and festivals designed to attract tourists) $105,200 5% towards LTAC Priorities (to be allocated at the discretion of the Committee) $43,800 Total Budget Available: $1,161,300 On November 15, 2023, the LTAC met to review and recommend awards for proposals submitted prior to the October 16th deadline. At this meeting the LTAC voted unanimously to approve a final 2024 LTAX Fund budget of $1,071,800. The details of this budget are attached to this memo. Funding: The estimated revenue the City anticipates receiving from lodging tax is $876,200. Utilizing reserve funds, the final recommended budget is $1,071,800. Attachments: 1.LTAC Vision, Goals and Priorities 2.LTAX Budget Proposal 3.Draft LTAC Meeting Minutes December 5, 2023 I - 2 Vision, Goals and Priorities for Lodging Tax Funding Programs Vision: To best utilize lodging tax funds to create a welcoming and inviting community with facilities and activities that increase tourism-related revenue through a sustainable visitor experience. Goals: 1.Foster and maintain a healthy and diverse tourism sector that continues to thrive. 2.Fully utilize and promote creative uses of existing facilities. 3.Improve the quality of experience and relationships for tourist and residents while diminishing any negative impacts from tourism-related activities and traffic. 4.Promote partnerships and increase tourism by concentrating on priorities identified by both residents and the tourism industry. 5.Focus on our unique Port Angeles assets that make us a premier destination for environmentally and fiscally sustainable recreation and tourism. 6.Encourage collaboration recognizing that Olympic Peninsula-based tourism supports and benefits all communities. Annual Funding Disbursement: The expected outcome of the funded activities is to increase economic activity in Port Angeles through the overnight lodging of tourists, through tourism-related expenditures, and construction of tourism-related facilities in accordance with RCW 67.28.1816 Funding categories and their percentage of annual expenditure should approximate: •Tourism-related capital facilities – 20% plus 5% reserved. Reserves are to be taken from the initial annual projected available revenues prior to LTAC consideration of expenditure allocation and budget for the annum. Capital Facility expenditures are to be used for: o New construction o Improvement and renovation •Tourism-related marketing – 25% •Tourism-related non-profit business operations – 33% •Events and festivals designed to attract tourists – 12% •LTAC Priorities – 5% Funding Priorities – Non-events: •Lend support to a diverse range of sustainable tourism activities to encourage visitors to enjoy longer stays and return often. •Support the increase of tourism capacity, where capacity is defined as the broad number activities within the community a visitor can attend, visit, or take part in when staying overnight. •Assist the maintenance establishment tourism related capital facilities including: o Wayfinding and Interpretative Signage, o Public Restrooms o Transportation facilities, and o Passive recreational park facilities (benches, walkways, and lighting). December 5, 2023 I - 3 • Support efforts to improve information on attractions and facilities. • Fund proposals that encourage and enhance tourism during the off-peak time as stated below. • Promote tourism that highlights Port Angeles assets – its natural beauty, geology, outdoor activities, anthropology, community events, lifelong learning opportunities, history, culture, and the arts. • Develop key community assets that function as destinations or venues for multipurpose events on a year-round basis. • Create partnerships and synergies with existing organizations to develop and promote attractions and events for visitors. • Develop innovative opportunities that improve the tourist/resident relationship • Improve effectiveness of coordinated transportation and trail linkages. • Support of organizations and projects that promote coordination and cooperation in tourism activities. Funding Priorities –Events: • Event Funding is capped at $10,000 per year per event for new events (events in operation for 5 years or less). • Event funding is capped at $5,000 per year per event for legacy events (events in operation 6 years or more). • Review events also based upon intangible benefits for the community, including arts and culture, local economic development, and regional/statewide/national/international exposure. • Lend support to a diverse range of tourism sustainable activities to encourage visitors to enjoy longer stays and return often. • Encourage events to become self-sufficient. • Encourage the creation of new events and off-peak that drive an increase in Lodging Tax. • Encourage the potential growth of existing events. Support of organizations and projects that promote coordination and cooperation in tourism activities. • Develop innovative opportunities that improve the tourist/resident relationship. • Support events that demonstrate regional marketing and marketing partnerships with other local/regional marketing organizations. • Support Projects that demonstrate a clear marketing strategy and business goals. Scoring Criteria for New Event Grant proposals – 100 possible points: 1. The project or event plan is clear, and the proposal reflects enough detail to effectively determine the potential to result in overnight stays by tourists in lodging establishments within the City. (25 pts.) 2. This project statistically demonstrates a result in overnight stays. (Room nights: 20 pts. – over 200, 15 pts. – 100-200, 10 pts. – 50-100, 5 pts. – less than 50) 3. The proposal demonstrates the organization is working in partnership with fellow organizations and businesses. (20 pts.) 4. The project has clear marketing goals and a defined promotion plan. (10 pts.) December 5, 2023 I - 4 5. This project occurs in non-demand periods (10 pts) 6. The project lends itself to the complement of other events in the community and helps create a diversity of opportunities (arts, culture, recreation, education, or historic significance) (10 pts.) 7. The event proposal defines additional revenue benefit beyond overnight stays (likely diners, shoppers, paid parking etc.) (5 pts.) Scoring Criteria for Legacy Event Grant proposals – 100 possible points: 1. Demonstrates a proven track record to result in overnight stays by tourists in lodging establishments within the City. (25 pts.) 2. Demonstrates ability for continued increase in overnight stays by tourists in lodging establishments within the City. (25 pts.) 3. This project occurs in non-demand periods. (20 pts) 4. The project lends itself to the complement of other events in the community and helps create a diversity of opportunities (arts, culture, recreation, education, or historic significance). (20 pts.) 5. The event proposal defines additional revenue benefit beyond overnight stays (likely diners, shoppers, paid parking etc.). (10 pts.) Scoring Criteria for Non-Event Proposals (Capital Facilities/Projects) – 30 possible points: 1. There is evidence provided that this project will help increase opportunities for tourism sustainable activities. 2. There is evidence provided that the project will encourage visitors to enjoy longer stays and return. 3. The project plan is clear with a timeline for action defined and the proposal reflects enough detail to effectively determine potential for success. 4. The budget provided reflects a clear understanding of the costs associated with this project and there is evidence that this budget is based on market research, structured estimates, or estimates provided by contractors. 5. The project supports LTAC priorities to increase transportation, quality of city infrastructure, wayfinding, or enhances the city’s natural assets to improve the overall look and feel and welcoming design of Port Angeles. 6. The project will support our local economy through local contracts, retail purchases, or partnerships. Scoring Criteria for Non-Event Proposals (Operations & Marketing) – 25 possible points: 1. There is evidence provided that organization or project will help increase or sustain opportunities for tourism related activities. 2. There is evidence provided that this organization or project will encourage visitors to enjoy longer stays or engage in return visits. 3. The proposal provides clear evidence that this organization can successfully draw tourists. December 5, 2023 I - 5 4. This project supports LTAC priorities to improve transportation, quality of city infrastructure, or wayfinding or enhances the city’s natural assets to improve the overall look and feel and welcoming design of Port Angeles. 5. This project clearly reflects how the funds will be used to help sustain a tourism-related business. Scoring for Non-Event Proposal Criteria Each criterion will be evaluated on the following spectrum: • Strongly Agree – 5 pts • Agree – 4 pts. • Neutral – 3 pts. • Disagree – 2 pts. • Strongly Disagree – 1 pt. • Did not answer – 0 pts. December 5, 2023 I - 6 Juan De Fuca Foundation for the Arts 25,000 Port Angeles Fine Arts Center 101,000 Lincoln Park BMX Association 39,800 City of Port Angeles Parks and Recreation Dept.60,000 Total Capital 225,800 Peninsula Trails Coalition 11,400 Hurricane Ridge Winter Sports Education Foundation 59,300 Lincoln Park BMX Association 5,000 Port Angeles Marathon Association 12,500 Port Angeles Youth Basketball 54,000 Port Angeles Fine Arts Center 20,000 Field Arts and Events Hall 100,000 Olympic Culinary Loop 5,000 Port Angeles Chamber of Commerce - Elevate PA 32,000 Utililties 1,500 Memberships 500 Debt Service 19,400 Right of Way Costs 3,800 Adminstrative Costs 38,000 Chamber of Commerce Contract 117,300 Total Operations 479,700 Olympic Peninsula Tourism Commission 32,000 Olympic Peninsula Tourism Commission - Co-op Ads 15,000 Destination Marketing Campaign 172,100 Total Marketing 219,100 2024 LODGING TAX COMMITTEE RECOMMENDED BUDGET CAPITAL OPERATIONS MARKETING December 5, 2023 I - 7 Wintertide Celebration of Light 10,000 Northwest Cup Race Weekend 1 5,000 Pacific Northwest Fiber Exposition 9,900 Raymond Carver and Tess Gallager Creative Writing Festival 10,000 Run the Peninsula: Elwha Bridge Run 5,000 SquatchCon Comics and Art Convention 10,000 Big Hurt/Little Hurt 3,500 North Olympic Discovery Marathon 5,000 Frosty Moss Relay 3,500 Juan De Fuca Festival for the Arts 4,500 Northwest Cup Race Weekend 2 5,000 Port Angeles Coastal Rowing Series 10,000 Salt Creek 24 Race 2,000 Northwest Cup Race Weekend 3 5,000 Concerts on the Pier 7,000 Sea to Sound 3,000 Port Angeles Rams Basketball 3,000 Port Angeles City Ballet Presents: The Nutcracker 2,000 Total Events 103,400 5% placed in capital reserve 43,800 Total Designation to Capital Reserve 43,800 2024 Total Recommended Lodging Tax Budget 1,071,800 Available Budget (Includes approved use of reserves)1,161,300 Unused Budget Remaining 89,500 EVENTS DESIGNATION TO CAPITAL RESERVE December 5, 2023 I - 8 Attachment 3 LODGING TAX ADVISORY COMMITTEE Port Angeles, Washington November 15, 2023 9:30 a.m. This meeting was conducted as a hybrid meeting. DRAFT CALL TO ORDER Chair Carr called the meeting to order at 9:31 a.m. ROLL CALL Voting Members Present: Navarra Carr, Christine Loewe, Donya Alward, Sydney Rubin, Victoria Jones (attending virtually). Member at Large Non-Voting Members: Rosylen Mangohig. Members Absent: None. Staff Present: Ben Braudrick, Melody Schnider, Hailey Jones, and Aubrianna Howell. APPROVAL OF MINUTES It was moved by Alward and seconded by Lowe to: Approve the November 3, 2022 minutes. Motion carried 5-0. PUBLIC COMMENT Tommy Farris, residing outside the city, spoke on behalf of Olympic Hiking Co and the Hurricane Ridge Winter Sports Education Foundation application. Details included the Hurricane Ridge winter shuttle, partnerships, and the importance of LTAC funding to their organization. Jerry Oaks, city resident, spoke on behalf of Hurricane Ridge Winter Sports Education Foundation and wanted to make a clarification on the application. Jeff Bohman, city resident, thanked the committee for the work they do and spoke to the benefits that the Olympic Discovery Trail and Peninsula Trails Collation has received in the past. Lorrie Mittmann, city resident, spoke to short term rental operations and their positive contributions to the LTAC funding. MarySue French, city resident, spoke in support of the Pacific Northwest Fibers Arts Expo application. Kate Robbins, city resident, spoke in support of the Port Angeles City Ballet application. Jess Grello, city resident, representing SquatchCon Comic & Arts Convention spoke on behalf of the organization and thanked the committee for past funding. Marsha Massey, part time city resident, spoke in support of the application for the Olympic Peninsula Visitor Bureau and Olympic Peninsula Tourism Commission. ACTION ITEMS 1.Review and Recommend Annual 2024 Lodging Tax Fund Budget Review Management Accountant Melody Schnider presented the initial approved 2024 budget for the LTAC committee and the available funding for applicants. Planning Supervisor Ben Braudrick discussed the application scoring process and results. Specifically, how applications were scored differently based on if the applicant were new or legacy and non -event applicants. December 5, 2023 I - 9 Lodging Tax Advisory Committee Minutes November 15, 2023 Page 2 Chair Carr suggested that the committee discuss application scoring in sections, capital, marketing, operation and events. Committee discussion followed. The Committee began reviewing the applications for the capital facilities budget and the use of funding. The applicants requested a total of $265,806. Chair Carr opened the floor for discussion. The Committee directed a question to the City of Port Angeles Parks & Recreation, but a representative was unable to speak on behalf of the application due to technical difficulties. A representative was able to answer the Committees questions later in the meeting. It was moved by Carr and seconded by Rubin to: Fully fund the requested amount to Juan de Fuca Foundation for the Arts, Port Angeles Fine Arts Center, and Lincoln Park BMX Association for the capital budget. Motion carried 5-0. The Committee moved on to discuss the applications for the marketing budget and the funding available. The applicants requested a total of $47,000. It was moved by Jones and seconded by Alward to: Fully fund both the marketing requests from the Olympic Peninsula Tourism Commission and Olympic Peninsula Tourism Commission -Co-op Ads at their full amount. Motion carried 5-0. The Committee moved on to discuss the applications for the events budget and the funding available. The applicants requested a total of $116,375. Port Angeles City Ballet application representative Kate Robbins answered a few clarifying questions regarding their application. Sea to Sound application representative Tina Woodward answered clarifying questions on funding. Committee discussion followed. It was moved by Carr and seconded by Lowe to: Fully fund all the applicants, with the exception of Sea to Sound funded at $3,000, Port Angeles Rams Basketball funded at $3,000, and the Port Angeles City Ballet Presents: The Nutcracker funded at $2,000. Motion carried 3-2 with Alward and Jones opposed. The City of Port Angeles Parks & Recreation representative Tim Tucker answered several questions relating to how the funding would impact the restoration of the Locomotive #4. Committee discussion followed. It was moved by Alward and seconded by Carr to: Fund the City of Port Angeles Parks & Recreation at $60,000. Motion carried 4-1 with Rubin opposed. Chair Carr opened the floor to discuss the application for the operations budget and the funding available. The applicants requested a total of $547,150. Port Angeles Chamber of Commerce representative MarySue French answered question regarding their application. It was moved by Carr and seconded by Alward: Fund all applicants in operation to their full request amounts with the exception of Field Arts and Events Hall funded at $100,000 and Port Angeles Chamber of Commerce - Elevate PA at funded at $32,000. Motion was carried 5-0. It was moved by Carr and seconded by Rubin to: Recommend the 2024 total Lodging Tax budget in the amount of $1,028,0000 to the Port Angeles City Council. Motion was carried 5-0. 2. Discussion/Action Item: 2024 Regular Meeting Scheduling Planning Supervisor Braudrick spoke to the 2024 Calendar for the regular LTAC Committee meetings. It was suggested by Planning Supervisor Braudrick the 4th Thursday of the month for regular meetings. The Committee agreed by consensus to meet on March 28th, June 20th, September 26th, November 7th from 11am to 1pm. December 5, 2023 I - 10 Lodging Tax Advisory Committee Minutes November 15, 2023 Page 3 STAFF UPDATES Planning Supervisor Braudrick gave a brief update on the strategic marketing plan. Management Accountment Schnider introduced Budget Officer Hailey Jones who will attending future LTAC meetings. COMMITTEE MEMBER UPDATES None. Chair Carr adjournment the meeting at 11:44am. __________________________ ___________________________ Navarra Carr, Chair Aubrianna Howell, Acting Clerk December 5, 2023 I - 11 Date: December 5, 2023 To: City Council From: Nathan A. West, City Manager Subject: Association of Washington Cities City Action Days Background / Analysis: City Council has historically participated at the annual AWC City Action Days in Olympia. The event provides an opportunity for Council members to engage with legislators and share the City’s legislative priorities, attend educational sessions, and interact with colleagues from around the State. During the 2023 event, Mayor Dexter, and Council members Schromen-Wawrin and Suggs joined Manager West in attendance. Funding Overview: Funding for participation in this event is included in the 2024 proposed budget, and includes hotel, registration and per diem for three Council members. Summary: In anticipation of the upcoming Association of Washington Cities (AWC) City Action Days to be held January 24-25, 2024 in Olympia, staff recommends that Council review schedules and discuss participation in the event. Funding: Funding for participation in this event is included in the 2024 proposed budget, and includes hotel, registration and per diem for three Council members. Recommendation: Discuss attendance at the AWC City Action Days for no more than three Council members. December 5, 2023 I - 12 December 5, 2023 I - 13 Date: December 5, 2023 To: City Council From: Nathan A. West, City Manager Subject: Multi-Organizational Meeting on Elwha Legacy Forest & Power Plant Timber Sale Background / Analysis: On September 5, 2023 City Council passed a motion to, “Direct the Mayor or City Manager to sign the joint letter on behalf of the City and send letters on behalf of the City of Port Angeles to the Board of Natural Resources, County Commissioners, and Lower Elwha Klallam Tribal Council regarding the City’s continued interest in preserving the Elwha River Watershed, and invite the Board of Natural Resources, County Commissioners, and Lower Elwha Klallam Tribal Council to a joint meeting about protecting our water supply.” At the November 8th meeting, Manager West provided an update from the Clallam County Board of Commissioners which included two alternatives to the requested meeting. This included a suggested single joint meeting between the City and County elected officials, or to invite the junior taxing districts to the multi-organization joint meeting along with the original invitees. The Department of Natural Resources replied to the City’s invitation for the multi-organization joint meeting on November 13, 2023, stating their organization would be interested in meeting and asked if City staff could provide suggested dates and times. At this time, City staff have not received a reply from the Lower Elwha Klallam Tribe. Staff is recommending that Council discuss next steps regarding the joint meeting request. Funding Overview: n/a Summary: During the September 5th, 2023, Port Angeles City Council meeting, Council directed staff to invite the Board of Natural Resources, Clallam County Commissioners, and Lower Elwha Klallam Tribal Council to a joint meeting to discuss opportunities to further protect the City’s sole source water supply. Funding: n/a Recommendation: Discuss next steps regarding the requested multi-organizational joint meeting. December 5, 2023 I - 14 Date: December 5, 2023 To: City Council From: Mike Healy, Director of Public Works & Utilities Subject: Lincoln Park - Big Boy Pond Study – Professional Services Agreement (PSA-2023-20) Background / Analysis: The Lincoln Park and Big Boy Ponds are integral stormwater detention and flow control facilities that are part of a large drainage network that eventually discharges to Tumwater Creek. Since the use of the ponds at Lincoln Park began in 1933, a relief gate has been utilized to avoid overflow by draining excess stormwater into the downstream depressional area near Stevens Middle School named Big Boy Pond. During some large rain events, Big Boy Pond is itself subject to overflow – leading to flood risk in nearby residential areas. To counteract this risk, a pump station was installed in 1999 on the Stevens Middle School property to move water from the pond to the City’s stormwater conveyance system, but this has been ultimately insufficient at offsetting the contributions to the pond during large storm events. During such events, the only available solution to prevent residential flooding, has been to manually close the Lincoln Park Pond relief gate and to instead allow excess stormwater to flood the Lincoln Park ball fields. The resulting cost to the City’s Parks Department in scheduling delays, staff time, and damages to the ball fields and infrastructure is one of the major impetuses for this project. The project includes several stakeholders, including the City, which owns Lincoln Park; residents near Big Boy Pond; the Port Angeles School District, whose property includes Big Boy Pond; and several other impacted and interested parties. Several key challenges include a lack of documentation for the installed pump station at Big Boy Pond, lack of easements for the infrastructure located on School District property, land use requirements related to area wetlands, and operation and maintenance responsibilities for the overall system. Summary: The Lincoln Park ponds experience seasonal flooding due to downstream constraints that result in costly repairs to the ball fields and spring scheduling delays. A project was added to the City’s Capital Facility Plan (CFP) in 2004 to investigate and resolve this reoccurring issue. This professional service contract with Parametrix, Inc. will provide the City with an engineering assessment and alternatives analysis report to determine and select the best option to resolve the problem. Funding: The 2024-2029 CFP includes funding for the Lincoln Park – Big Boy Pond Study project (DR0804) in the amount of $138,000. The remaining $13,604.23 necessary to complete the work will come from Stormwater Reserves; for a total project cost of $151,604.23. Recommendation: Award a Professional Services Agreement to Parametrix, Inc. to perform the Big Boy Pond Study project for a maximum amount not to exceed $151,604.23, and authorize the City Manager to execute the agreement and to make minor modifications to the contract, as necessary. December 5, 2023 J - 1 This project is included in the approved 2024-2029 Capital Facilities Plan and will determine the most effective means available to reduce localized flooding in the Lincoln Park/Big Boy Pond drainage system and will begin the process to address and resolve the additional challenges described above. The City advertised a Request for Qualifications (RFQ) on May 11th, 2023 with qualifications due by June 2, 2023, to perform the work on the City website and to local professional services firms via the MRSC Roster; unfortunately, without response. Therefore, u sing the MRSC Roster for the basis of selection, seven qualified firms were evaluated as potential candidates for performing the work . Two firms were contacted who both responded with their interest to perform the work and were interviewed. Parametrix Inc. was ultimately selected as most qualified and began working with the City to develop and negotiate a Scope of Work and Professional Services Agreement (PSA). Professional Services Rationale: The tasks supported by this Professional Services Agreement require personnel with specialized subject matter and expertise in wetland assessment and delineation, surveying, hydrologic analysis, pump station evaluation, as well as several other unique skills sets the City does not currently retain in-house or have staff time available to perform. For this reason, the City is seeking outside support. Summary of Tasks and Budget Tasks Budget 1 Project Management $35,525.50 2 Alternatives Analysis $113,182.23 Anticipated Direct Expenses $2,896.50 Total $151,604.23 Funding Overview: Funds for this project are approved in the 2024-2029 approved CFP and available for use in 2023 and 2024 in the amount of $110,000 and $28,000, respectively, for a total of $138,000. The CFP project number is DR0804 and the project budget account is 456-7688-594-6510. The remaining funds necessary to complete this work will come from Stormwater Reserves in the amount of $13,604.23; for a total not-to-exceed project amount of $151,604.23. December 5, 2023 J - 2 AGREEMENT FOR PROFESSIONAL SERVICES BETWEEN CITY OF PORT ANGELES AND PARAMETRIX, INC. PSA-2023-20 RELATING TO: LINCOLN PARK - BIG BOY POND STUDY THIS AGREEMENT is made and entered into, by and between THE CITY OF PORT ANGELES, a non-charter code city and municipal corporation of the State of Washington, (hereinafter called the "CITY") and PARAMETRIX, INC., a Washington State corporation authorized to do business in the state of Washington (hereinafter called the "CONSULTANT"). WHEREAS, the CITY desires engineering, and consulting assistance related to the completion of the alternatives analysis and preliminary design of the Lincoln Park-Big Boy Pond Study project including: definition of the problem statement, data collection, property ownership research, stakeholder coordination, hydrologic and hydraulic modeling, and finally an alternatives analysis resulting in the selection of a preferred alternative. WHEREAS, the CITY desires to engage the professional services and assistance of a qualified engineering firm to perform the Scope of Services as detailed in Exhibit A; and WHEREAS, the CONSULTANT represents that it is in full compliance with the statutes of the State of Washington for professional registration and/or other applicable requirements; and WHEREAS, the CONSULTANT represents that it has the background, experience, and ability to perform the work requested by the CITY in accordance with the standards of the profession; and WHEREAS, the CONSULTANT represents that it will provide qualified personnel and appropriate facilities necessary to accomplish the work. NOW, THEREFORE, in consideration of the above representations and the terms, conditions, covenants, and agreements set forth below, the parties hereto agree as follows: I SCOPE OF SERVICES General Scope The CONSULTANT will accomplish the work as described in scope of services attached in Exhibit A. The CITY may review the CONSULTANT'S services, and if they do not meet the Professional Standard of Care the CONSULTANT shall make such changes as may be required by the CITY. Such changes shall not constitute "Extra Work" as related in Section XII of this Agreement. Any changes made necessary due to causes outside the CONSULTANT’S reasonable control shall be provided as an extra work herein. DRAFTDecember 5, 2023 J - 3 The CONSULTANT agrees that all services performed under this Agreement shall be in accordance with the standards of the engineering profession for similar services on similar projects of like size and nature and in compliance with applicable federal, state and local laws existing at the time the services are performed. The Scope of Services may be amended upon written approval of both parties. II OWNERSHIP OF DOCUMENTS Upon completion of the work, all written and electronic documents, exhibits, CAD files, project plans, engineering reports, or other presentations of the work directed by the CITY in Exhibit A with the exception of those standard details and specifications regularly used by the CONSULTANT in its normal course of business shall upon payment of all amounts rightfully owed by the CITY to the CONSULTANT herein become the property of the CITY for use without restriction and without representation as to suitability for reuse by any other party unless specifically verified or adapted by the CONSULTANT. However, any alteration of the documents, by the CITY or by others acting through or on behalf of the CITY, will be at the CITY's sole risk. III DESIGNATION OF REPRESENTATIVES Each party shall designate its representatives in writing. The CONSULTANT'S representative shall be subject to the approval of the CITY. IV TIME OF PERFORMANCE The CONSULTANT may begin work upon execution of this Agreement by both parties and written direction to proceed from CITY and the duration of the Agreement shall extend through December 31, 2024. V PAYMENT The CITY shall pay the CONSULTANT as set forth in this section of the Agreement. Such payment shall be full compensation for work performed, services rendered, and all labor, materials, supplies, equipment and incidentals necessary to complete the work. A. Payment shall be on the basis of the CONSULTANT'S cost for actual labor, overhead and profit plus CONSULTANT'S direct non-salary reimbursable costs as set forth in the attached Exhibit B. B. The CONSULTANT shall submit invoices to the CITY on a monthly basis. Invoices shall detail the work, hours, employee name, and hourly rate; shall itemize with receipts and invoices the non-salary direct costs; shall indicate the specific task or activity in the Scope of Service to which the costs are related; and shall indicate the cumulative total for each task. C. The CITY shall review the invoices and make payment for the percentage of the project DRAFTDecember 5, 2023 J - 4 that has been completed less the amounts previously paid. D. The CONSULTANT’S invoices are due and payable within 30 days of receipt. In the event of a disputed billing, only the disputed portion will be withheld from payment. E. Final payment for the balance due to the CONSULTANT will be made after the completion of the work and acceptance by the CITY. F. Payment for "Extra Work" performed under Section XII of this Agreement shall be as agreed to by the parties in writing. VI MAXIMUM COMPENSATION Unless otherwise agreed to in writing by both parties, the CONSULTANT'S total compensation and reimbursement under this Agreement, including labor, direct non-salary reimbursable costs and outside services, shall not exceed the maximum sum of $151,604.23. The budget for each task is as set forth in the attached Exhibit B. Budgets for task(s) may be modified upon mutual agreement between the two parties, but in any event, the total payment to CONSULTANT shall not exceed $151,604.23. VII INDEPENDENT CONTRACTOR STATUS The relation created by this Agreement is that of owner-independent contractor. The CONSULTANT is not an employee of the CITY and is not entitled to the benefits provided by the CITY to its employees. The CONSULTANT, as an independent contractor, has the authority to control and direct the performance within the Scope of Service. The CONSULTANT shall assume full responsibility for payment of all federal, state, and local taxes or contributions imposed or required, including, but not limited to, unemployment insurance, Social Security, and income tax. VIII EMPLOYMENT Employees of the CONSULTANT, while engaged in the performance of any work or services under this Agreement, shall be considered employees of the CONSULTANT only and not of the CITY, and claims that may arise under the Workman's Compensation Act on behalf of said employees while so engaged, and any and all claims made by a third party as a consequence of any negligent act or omission on the part of the CONSULTANT'S employees while so engaged, on any of the work or services provided to be rendered herein, shall be the sole obligation and responsibility of the CONSULTANT. In performing this Agreement, the CONSULTANT shall not employ or contract with any CITY employee without the CITY's written consent. CONSULTANT shall not accept any employment or perform any services where there is, or reasonably could arise, a conflict between the interests of the CITY and the interests of any of CONSULTANT’S other clients. IX NONDISCRIMINATION DRAFTDecember 5, 2023 J - 5 The CONSULTANT shall conduct its business in a manner, which assures fair, equal and non- discriminatory treatment of all persons, without respect to race, creed or national origin, or other legally protected classification and, in particular: A. The CONSULTANT shall maintain open hiring and employment practices and will welcome applications for employment in all positions, from qualified individuals who are members of minorities protected by federal equal opportunity/affirmative action requirements; and, B. The CONSULTANT shall comply with all requirements of applicable federal, state, or local laws or regulations issued pursuant thereto, relating to the establishment of nondiscriminatory requirements in hiring and employment practices and assuring the service of all persons without discrimination as to any person's race, color, religion, sex, Vietnam era veteran status, disabled veteran condition, physical or mental handicap, or national origin. X SUBCONTRACTS A. The CONSULTANT shall not sublet or assign any of the work covered by this Agreement without the written consent of the CITY. B. In all solicitation either by competitive bidding or negotiation made by the CONSULTANT for work to be performed pursuant to a subcontract, including procurement of materials and equipment, each potential sub-consultant or supplier shall be notified by the CONSULTANT of CONSULTANT's obligations under this Agreement, including the nondiscrimination requirements. XI CHANGES IN WORK Other than changes directed by the CITY as set forth in Section I above, either party may request changes in the Scope of Services. Such changes shall not become part of this Agreement unless and until mutually agreed upon and incorporated herein by written amendments to this Agreement executed by both parties. XII EXTRA WORK The CITY may desire to have the CONSULTANT perform work or render services in connection with this Agreement, in addition to the Scope of Services set forth in Exhibit A and minor revisions to satisfactorily completed work. Such work shall be considered as "Extra Work" and shall be addressed in a written supplement to this Agreement. The CITY shall not be responsible for paying for such extra work unless and until the written supplement is executed by both parties. XIII TERMINATION OF AGREEMENT A. The CITY may terminate this Agreement at any time, with or without cause, upon not less than ten (10) days written notice to the CONSULTANT. Written notice will be by certified mail sent to the CONSULTANT's designated representative at the address provided by the DRAFTDecember 5, 2023 J - 6 CONSULTANT. As a condition precedent to termination with cause the CONSULTANT shall be given the notice period to cure such cause and shall have failed to so cure. B. In the event this Agreement is terminated prior to the completion of the work, a final payment shall be made to the CONSULTANT, which, when added to any payments previously made, shall compensate the CONSULTANT for the work completed. C. In the event this Agreement is terminated prior to completion of the work, documents that are the property of the CITY pursuant to Section II above, shall be delivered to and received by the CITY prior to transmittal of final payment to the CONSULTANT. XIV FORCE MAJEURE A. Definition. For the purposes of this Agreement, “Force Majeure” means an event which is beyond the reasonable control of a Party including, but not limited to (1) strikes, lockouts, work slowdowns or stoppages, or accidents, (2) acts of God, and (3) delay caused by an act or omission of the other Party, and which makes a Party’s performance of its obligations under the Agreement impossible or so impractical as to be considered impossible under the circumstances B. No Breach of Agreement. The failure of a Party to fulfill any of its obligations under the Agreement shall not be considered to be a breach of, or default under, this Agreement insofar as such inability arises from an event of Force Majeure, provided that the Party affected by such an event has taken all reasonable precautions, due care and reasonable alternative measures in order to carry out the terms and conditions of this Agreement, and has informed the other Party as soon as possible about the occurrence of such an event. C. Extension of Time. Any period within which a Party shall, pursuant to this Agreement, complete any action or task, shall be extended for a period equal to the time during which such Party was unable to perform such action as a result of Force Majeure. XV INDEMNIFICATION/HOLD HARMLESS CONSULTANT shall, indemnify and hold the CITY, its officers, officials, and employees harmless from any and all injuries, damages, losses or suits including attorney fees, arising out of or resulting from the negligent acts, errors or omissions of the CONSULTANT in performance of this Agreement, except for injuries and damages caused by the concurrent negligence of the CITY. However, should a court of competent jurisdiction determine that this Agreement is subject to RCW 4.24.115, then, in the event of liability for damages arising out of bodily injury to persons or damages to property caused by or resulting from the concurrent negligence of the CONSULTANT, the CITY, and the officers, officials, employees, and volunteers of either, the CONSULTANT'S liability hereunder shall be only to the extent of the CONSULTANT'S negligence. It is further specifically and expressly understood that the indemnification provided herein constitutes the CONSULTANT'S waiver of immunity under Industrial Insurance, Title 51 DRAFTDecember 5, 2023 J - 7 RCW, solely for the purposes of this indemnification. This waiver has been mutually negotiated by the parties. The provisions of this section shall survive the expiration or termination of this Agreement. XVI INSURANCE The CONSULTANT shall procure and maintain for the duration of the Agreement, insurance against claims for injuries to persons or damage to property which may arise from or in connection with the performance of the work hereunder by the CONSULTANT, its agents, representatives, or employees. No Limitation. CONSULTANT’S maintenance of insurance as required by the Agreement shall not be construed to limit the liability of the CONSULTANT to the coverage provided by such insurance, or otherwise limit the CITY’S recourse to any remedy available at law or in equity. A. MINIMUM SCOPE OF INSURANCE Consultant shall obtain insurance of the types described below: 1. Automobile Liability insurance covering all owned, non-owned, hired and leased vehicles. Coverage shall be written on Insurance Services Office (ISO) form CA 00 01 . 2. Commercial General Liability insurance shall be at least as broad as ISO occurrence form CG 00 01 and shall cover liability arising from premises, operations, stop-gap, independent contractors and personal injury and advertising injury. The CITY shall be named as an additional insured under the Consultant’s Commercial General Liability insurance policy with respect to the work performed for the CITY using as additional insured endorsement at least as broad as ISO endorsement CG 20 26. 3. Workers’ Compensation coverage as required by the Industrial Insurance laws of the State of Washington. 4. Professional Liability insurance appropriate to the Consultant’s profession. B. MINIMUM AMOUNTS OF INSURANCE Consultant shall maintain the following insurance limits: 1. Automobile Liability insurance with a minimum combined single limit for bodily injury and property damage of $1,000,000 per accident. 2. Commercial General Liability insurance shall be written with limits no less than $2,000,000 each occurrence, $2,000,000 general aggregate. 3. Professional Liability insurance shall be written with limits no less than $2,000,000 per claim and $2,000,000 policy aggregate limit. C. OTHER INSURANCE PROVISION DRAFTDecember 5, 2023 J - 8 The CONSULTANT’S Automobile Liability and Commercial General Liability insurance policies are to contain, or be endorsed to contain, that they shall be primary insurance as respect the CITY. Any Insurance, self-insurance, or insurance pool coverage maintained by the CITY shall be excess of the CONSULTANT’S insurance and shall not contribute with it. D. ACCEPTABILITY OF INSURERS Insurance is to be placed with insurers with a current A.M. Best rating of not less than A:VII. E. VERIFICATION OF COVERAGE CONSULTANT shall furnish the CITY with original certificates and a copy of the amendatory endorsements, including but not necessarily limited to the additional insured endorsement, evidencing the insurance requirements of the Agreement before commencement of the work. F. NOTICE OF CANCELLATION The CONSULTANT shall provide the CITY with written notice of any policy cancellation, within two business days of their receipt of such notice. G. FAILURE TO MAINTAIN INSURANCE Failure on the part of the CONSULTANT to maintain the insurance as required shall constitute a material breach of contract, upon which the CITY may, after giving five business days notice to the CONSULTANT to correct the breach, immediately terminate the contract or, at its discretion, procure or renew such insurance and pay any and all premiums in connection therewith, with any sums so expended to be repaid to the CITY on demand, or at the sole discretion of the CITY, offset against funds due the CONSULTANT from the CITY. H. CITY FULL AVAILABILITY OF CONSULTANT LIMITS If the CONSULTANT maintains higher insurance limits than the minimums shown above, the CITY shall be insured for the full available limits of Commercial General and Excess or Umbrella liability maintained by the CONSULTANT, irrespective of whether such limits maintained by the CONSULTANT are greater than those required by this Agreement or whether any certificate of insurance furnished to the CITY evidences limits of liability lower than those maintained by the CONSULTANT. XVII APPLICABLE LAW This Agreement shall be construed and interpreted in accordance with the laws of the State of Washington, and in the event of dispute the venue of any litigation brought hereunder shall be Clallam County. XVIII CONFLICTS In the event there is any conflict between the terms and conditions contained in this AGREEMENT and the terms and conditions contained in Exhibit A or in any other document that is incorporated into or made a part of the contract between the CONSULTANT and the CITY, the terms and conditions of this AGREEMENT shall control. DRAFTDecember 5, 2023 J - 9 XIX SUBMITTALS AND DOCUMENT CONTROL The CITY reserves the right to utilize an online cloud-based project management system, Virtual Project Manager (VPM). VPM allows for paperless documentation and project administration. For more information, go to https://www.virtual-pm.com/. XX EXHIBITS AND SIGNATURES This Agreement, including its exhibits, constitutes the entire Agreement, supersedes all prior written or oral understandings, and may only be changed by a written amendment executed by both parties. The following exhibits are hereby made a part of this Agreement: Exhibit A – Scope of Services Exhibit B – Budget This Agreement is effective and binding as of the date for the last signature affixed below. PARAMETRIX, INC CITY OF PORT ANGELES By: _______________________________________ Printed Name: Cindy Clark By: ________________________________________ Printed Name: Nathan West Title: Regional Division Manager Title: City Manager Date: ______________________________________ Date: _______________________________________ APPROVED AS TO FORM: BY: ____________________________________ CITY ATTORNEY ATTEST: BY: ____________________________________ CITY CLERK DRAFTDecember 5, 2023 J - 10 EXHIBIT A SCOPE OF SERVICES SCOPE OF WORK City of Port Angeles Lincoln Park/Big Boy Pond INTRODUCTION The City of Port Angeles (City) requested that Parametrix (Consultant) review the Lincoln Park and Big Boy ponds that are an integral part of the stormwater detention and flow control facilities within the Tumwater Creek drainage basin. Since the formation of the ponds in 1933, a relief gate has been utilized to avoid overflow by draining excess stormwater into the wetland that contains Big Boy Pond. During some large rain events that require the relief gate to be opened, Big Boy Pond is itself subject to overflow leading to flood risk in nearby residential areas. To counteract this risk, a pump station was installed in 1999 on the Stevens Middle School property to move water from the pond to the stormwater system, but this has been ineffective at offsetting the contributions to the pond during large storm events. During such events, the only available solution to prevent residential flooding has been to manually close the Lincoln Park Pond relief gate and to then allow overflow to flood the Lincoln Park ball fields resulting in delays, staff time, and damages to Lincoln Park’s functionality. The project includes several stakeholders including the City, who owns Lincoln Park; residents near Big Boy Pond; the Port Angeles School District; and several other parties. Several key challenges noted by the City include a lack of documentation for easements on the Stevens Middle School property, land use requirements related to wetland regulations, and ultimately what responsibilities the parties involved have in maintaining a healthy environment, stormwater system and social dynamic. This study will determine the most effective means available to eliminate localized flooding in the Lincoln Park/Big Boy Pond drainage system. This scope of work covers the completion of the alternatives analysis phase of this project including: definition of the problem statement, data collection, property ownership research, stakeholder coordination, hydrologic and hydraulic modeling, and finally an alternatives analysis resulting in the selection of a preferred alternative. Work to complete final design will be added to the scope of work via future contract amendments. SCHEDULE A six-month duration is assumed to complete this scope of work, which includes project start through selection of the preferred alternative. TASK 01 – PROJECT MANAGEMENT DRAFTDecember 5, 2023 J - 11 Subtask 01 – Project Management Objectives The objective of this subtask is to provide overall Project management of the Consultant contract with the City. Approach This subtask includes general management functions as follows: •Schedule and coordinate the work of Consultant team members and ensure that work is completed accurately and within scope and budget. •Coordinate with City staff including the following: Prepare and submit monthly progress billings to the City. Provide additional identification of issues and proposed solutions if unforeseen issues arise. Provide a design schedule. •Meet with the City virtually for design review and project kick-off meetings on up to two occasions as follows: Kick-off Workshop with City staff and the Project team to confirm design objectives, issues, and schedule. Review Alternative Analysis. •Meet with the City for regular coordination virtually on up to six occasions as follows: Once monthly coordination meetings outside of the formal design review meetings noted above. Deliverables Deliverables for this subtask include the following: •Monthly progress reports and invoices (6). •Meeting agendas and notes for the two (2) City design review meetings noted above. •Project design schedule (1). Assumptions Assumptions for this subtask include the following: •Delays due to unforeseen circumstances (i.e., additional meetings or extended review periods) may result in additional effort necessary for project management and administration which may require a supplement. •Virtual design review meetings (i.e., kick-off, alternatives analysis) will be attended by up to four (4) Consultant staff and will require a total of 2 hours each. •Monthly video conference calls with City staff will be attended by up to two (2) Consultant staff and will require a total of 1 hour each. Subtask 02 – Quality Control/Quality Assurance Goal DRAFTDecember 5, 2023 J - 12 To prepare a quality management plan for the Project and to complete internal quality reviews of each deliverable as noted below. Approach Consultant will perform quality control and quality assurance reviews of each deliverable as follows: •Data collection memorandums (3) •Alternatives Analysis Memorandum Deliverables •Independent quality reviews of each deliverable listed on Consultant internal standard comment response sheets (electronic PDF format) •Quality Management Plan (PDF format) Assumptions •Deliverables for Subtask 01.02 will be made available to the City upon request. Subtask 03 – Stakeholder Coordination Meetings Goal To assist the City with stakeholder coordination and understanding of development activities by the Port Angeles School District, Clallam County Parks, or other agencies that may interface with the project limits. See Subtask 1.01 project management team coordination meetings. Activities Consultant will attend up to 2 stakeholder coordination meetings with this scope of work. Because individuals, subject matter, and timing are unknown at this time, the work will be approved by the City on an as-needed basis only. Consultant will prepare meeting agendas and notes for these meetings. In general, these meetings will include: •Parks, at project kickoff; review scope, access, documentation needs, schedule, approach, etc. •School District, at mid-point of Alternatives Analysis; review questions and other technical items Deliverables •Agenda and meeting minutes Assumptions •These meetings will occur virtually. Each meeting will last approximately 2 hours. •Virtual meetings will be attended by up to three Consultant staff. •Two hours have been allotted for each meeting to prepare an agenda and summarize notes. •Additional stakeholder coordination meetings will be required for final design. •No meeting specific graphics will be prepared for Subtask 01.03. Graphics and drawings prepared under other Subtasks in this scope of work can be used for the stakeholder coordination meetings.DRAFTDecember 5, 2023 J - 13 Subtask 04 – Directed Services Goal The purpose of this task is to facilitate a timely response by Consultant for additional project-related needs that arise above and beyond the current scope. Approach Consultant shall provide professional engineering services and technical assistance to the City at the direction of authorized City staff. A scope and estimated fee, including any expenses, shall be prepared and approved by the City in advance of any work. TASK 02 – ALTERNATIVES ANALYSIS Subtask 01 – Data Collection Goal Under this task, existing data about the pond system will be collected and reviewed. This will include staff interviews, review of historic information, prior studies, as-built data, photos, mapping and gauge data. This review will help to identify any data gaps and develop an understanding of the hydraulic workings of the City system which will provide the basis for the development of solutions for reduction of flooding impacts. Information on the Lincoln Park Pond controls and operations will be collected through staff interviews, survey, and a field visit. Additionally, information on the Big Boy pond pump system will be collected including the pump capacity, age, condition, and considerations for maintenance intervals, spare parts, upgrades, or replacement. This information for both the Lincoln Park Ponds and Big Boy pump system will be summarized in a short technical memorandum. Approach Consultant will perform the following activities: •Interview with City staff/former staff on pond controls and pump operations, history, and maintenance concerns. •Complete an on-site pump system evaluation. •Complete an on-site pond system evaluation. Deliverables •Data review summary email (electronic email format). Assumptions The following assumptions apply to this subtask: •The City will provide any available data to Consultant for review. •One site visit with up to two Consultant staff. This site visit will be completed in one 12-hour day including travel.DRAFTDecember 5, 2023 J - 14 Subtask 02 – Wetland Assessment Goal To collect information regarding the extent of wetlands located near Big Boy Pond and the hydrologic and vegetation conditions within them. This information will be used as a baseline to compare the effects of the project alternatives on the existing conditions. Approach Consultant scientists will conduct an assessment of Big Boy Pond’s wetland conditions including delineating boundaries, characterizing the vegetation conditions and indicators of hydrologic conditions (water marks, wrack, inlets and outlets), and wetland rating using Washington State Department of Ecology’s 2014 Wetland Rating System for Western Washington. Scientists will conduct a desktop background review of the study area prior to field surveys. They will install up to 4 groundwater wells or water surface staff gauges equipped with data recording pressure transducers to collect ground- and surface-water elevation data. These gauges will be used to measure the water elevations in the wetlands and compare those dynamics to precipitation. This data will be used as a baseline to compare the potential design alternatives. The effects of those alternatives (changing water elevation depths and/or durations) on the existing wetland vegetation and wildlife habitat will be modeled and described in a Wetland Impacts Assessment in a future project phase. The wetland boundary will be surveyed as described in Subtask 02.03. The report shall describe all means and methods used to perform the wetland assessment, delineation, and characterization and shall include all supporting documents, photos, maps, data forms, rating forms, and figures in the appendices. Deliverables •Wetland Delineation and Categorization Report (Draft for review by City, PDF) •Wetland Delineation and Categorization Report (Final PDF) •Wetland Delineation GIS shapefiles Assumptions •The City will provide one set of consolidated comments on the Draft deliverables for discussion with Consultant and integration into a Final Draft •The City will provide right-of-entries and property owner communication needed to complete the assessment. •There is one wetland associated with Big Boy Pond. •The City will collect gauge data monthly and provide it to Consultant through December 2024. •Based on conversations with the City, it is assumed that the Lincoln Park stormwater pond was constructed in upland and therefore not a jurisdictional feature. •Consultant scientists will prepare a Wetland Impacts Assessment and be available to support the City in its correspondence with Ecology regarding the Wetland Impacts Assessment as desired and directed by the City via a future phase of the project and under a future contract amendment. Subtask 03 – Topographic Survey and Ownership Determination DRAFTDecember 5, 2023 J - 15 Goal The purpose of this subtask is to complete the field control work, and to include some topographic elements to aid in the alternatives analysis process. Approach Parametrix will conduct the following: •Topographic elements will include Valve Number 1, 2, 3, 4 and Wier depicted on Figure A for the Lincoln Park Pond Drainage, wetland flags marked at Big Boy Pond, and the pipe and structure inverts, size, and material for the limits highlighted in Pink on Figure B. Figure A DRAFTDecember 5, 2023 J - 16 Figure B Deliverables Deliverables for this subtask include the following: •One (1) paper copy of the topographic elements survey. •An electronic drawing file of the topographic elements survey in AutoCAD Civil 3D 2022 format in one drawing file. Assumptions The following assumptions apply to this subtask: •Survey will include pipes and structures from Lauridsen Boulevard to the pump system outlet at D Street, including valve and controls. •Lidar will be used to develop storage data for the existing stormwater detention ponds at Lincoln Park and Big Boy pond. •Right of entry will be obtained from property owners by the City for the location of the existing stormwater detention pond and adjacent properties. •City will coordinate access with property owners. •Wetland assessment, identification, and field markings will be completed prior to mobilizing for the field survey. •The setting of any survey monuments at any of the exterior boundary points of the subject property has not been included in this proposal. Boundary determination is not included in this scope of work. This service can be provided if required at a later date. Additionally any setting of property corners, and filing of a Record of Survey (if required) will be considered Additional Services and billed separately. •All electronic mapping standards will be based on Parametrix drafting standards.DRAFTDecember 5, 2023 J - 17 •Parametrix field crews may need to perform minor brushing with machetes to conduct this survey and we have the City’s permission to do so. •Unless otherwise specified by the client, horizontal datum shall be North American Datum (NAD) 83/91 Washington Coordinate System, North Zone, and vertical datum shall be North American Vertical Datum of 1988 (NAVD 88). Subtask 04 – Hydrologic and Hydraulic Analysis Goal The purpose of this task is to evaluate the existing and proposed hydrologic and hydraulic conditions in the Lincoln Park and Big Boy ponds basin for use in the evaluation of retrofit options. Approach Existing City delineations will be reviewed and modified based on topography, storm drainage infrastructure, and data collected in Subtasks 02.01, 02.02, and 02.03. •Delineation review and field confirmation of areas in question. •Basin characterization. •Hydrology and Hydraulic modeling. •Model checks and calibration. Deliverables •EPA Stormwater Management Model files. •Additional modeling documentation will be provided in the project summary report in Subtask 02.05. Assumptions •Western Washington Hydrology Model will be used to evaluate system hydrology. •EPA Stormwater Management Model will be used to evaluate pond hydraulics. •Checks will be performed based on information available from up to two historic flood conditions through water mark/gage readings, photos, or City accounts. This information will be provided to Consultant by the City. Subtask 05 – Alternatives Analysis Goal This subtask is to develop, evaluate, and coordinate retrofit options for the existing ponds, conveyance, controls and/or pump system. Approach Consultant will perform the following: •Prepare up to three retrofit options and evaluations for reducing flooding. •Lead a virtual workshop to discuss the proposed alternatives and modifications.DRAFTDecember 5, 2023 J - 18 •Coordinate with City staff for scoring of the alternatives using a multi-objective decision analysis to help inform the options. •Prepare an alternative analysis technical memorandum outlining the basis-of-design of the preferred alternative to describe the proposed retrofit options. Deliverables Consultant will provide the following: •Draft and final technical memoranda to describe the project retrofit options and selected alternatives. Assumptions The following assumptions apply to this subtask: •The workshop will be held virtually, will have a duration of 6 hours including travel, and will include two Consultant staff members. •The technical memorandum will be a maximum of 10 pages, not including attachments. •The draft technical memorandum will be submitted to the City two weeks prior to the workshop. •The City will identify the selected preferred alternative within two weeks following the workshop. Advancement of the preferred alternative design may be completed via future contract amendment. •Cost estimates will not be provided for the alternatives. TASK 03 – FINAL DESIGN (FUTURE TASK) END OF EXHIBIT A DRAFTDecember 5, 2023 J - 19 EXHIBIT B BUDGET CONSULTANT will perform the scope of work in Exhibit A on an hourly basis per Exhibit B. DRAFTDecember 5, 2023 J - 20 Mallory WildeSr ConsultantTheo PrinceSr EngineerPaul FendtPrincipal ConsultantNikki ReddenEngineer IIIJoel LinkeSr EngineerKristy AllinsonSurvey SupervisorKen Van CleaveSr SurveyorSteven SharpeTechnical LeadMichael D'AgostinoSurveyor IIIBridget MacchioneSurveyor IIJosh WozniakSr ConsultantKaylee MoserScientist/Biologist IIIChad TinsleySr GIS AnalystAmanda WeissScientist/Biologist IIChristy PopeSr Project Cntl SpecSarah CrackenbergerSr. Pjct. AccountantAmanda LucasPublications SprvsrExhibit BBudget - Lincoln Park and Big Boy Pond ProjectAssumptions: - Labor rates based off of a 3.1 multiplier $258.20 $217.43 $323.70 $138.51 $237.99 $207.55 $146.88 $142.01 $136.52 $106.95 $246.73 $144.83 $156.49 $113.71 $170.16 $126.36 $140.59 Task Subtask Description Hrs Cost 01 01 Project Management 77 $17,156.55 37 20 0 4 0 0 0 0 0 0 2 0 0 0 10 4 0 17,156.55$ Monthly Calls (6 mos)12 $2,853.80 6 6 Progress Reports (6 mos)15 $2,993.45 7 4 4 Project Management - General (6 mos)24 $5,423.95 12 6 6 Schedule Management 4 $1,032.80 4 Kickoff Workshop 12 $2,673.01 4 4 2 2 Alternatives Analysis Review 10 $2,179.55 4 4 2 01 02 Quality Control/Quality Assurance 14 $4,138.81 6 0 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4,138.81$ Prepare QMP 2 $516.40 2 Review Data Collection Summary Memorandum 6 $1,811.21 2 4 Review Alternatives Analysis Memorandum 6 $1,811.21 2 4 01 03 Stakeholder Coordination Meetings 16 $4,230.14 8 4 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4,230.14$ Virtual stakeholder coordination meetings (2) 16 $4,230.14 8 4 4 01 04 Directed Services $10,000.00 02 01 Data Collection 90 $16,043.18 2 32 0 40 8 0 0 0 0 0 0 0 0 0 0 0 8 16,043.18$ Site Visit 24 $4,271.30 12 12 Pump System Evaluation 16 $2,929.75 4 8 4 Pond System Evaluation 32 $5,777.28 12 16 4 Summary email 18 $3,064.85 2 4 4 8 02 02 Wetland Assessment 126 $17,147.59 2 4 0 0 0 0 0 0 0 0 2 56 0 58 0 0 4 17,147.59$ Background Analysis 8 $1,158.66 8 Big Boy Pond Wetland Delineation and Report 74 $10,031.35 2 2 2 24 40 4 Well/Gauge install 44 $5,957.58 2 24 18 02 03 Topographic Survey and Ownership Determination 104 $13,616.50 0 2 0 0 0 4 0 16 40 40 0 0 0 0 2 0 0 13,616.50$ Field Topo Wetlands and Drainage 104 $13,616.50 2 4 16 40 40 2 02 04 Hydrologic and Hydraulic Analysis 144 $23,854.75 4 24 4 104 8 0 0 0 0 0 0 0 0 0 0 0 0 23,854.75$ Hydrology data and model set-up 36 $5,301.99 4 32 Hydraulics - data. Level pool, and profile 42 $6,688.13 2 8 32 Scenario testing 66 $11,864.63 2 12 4 40 8 02 05 Alternatives Analysis 246 $42,520.22 4 38 16 160 20 0 0 0 0 0 0 0 0 0 0 0 8 42,520.22$ Prepare up to three retrofit options and evaluations for reducing flooding. 87 $14,852.57 1 12 4 60 10 Lead a workshop to discuss the proposed alternatives and modifications. 13 $2,976.78 1 4 4 4 Coordinate with City staff for scoring of the alternatives using a multi-objective decision analysis to help inform the options. 43 $7,289.87 1 6 4 32 Prepare an alternative analysis technical memorandum outlining the basis-of-design of the preferred alternative to describe the proposed retrofit options. 103 $17,401.01 1 16 4 64 10 8 #REF! Total 817 $148,707.73 63 124 32 308 36 4 0 16 40 40 4 56 0 58 12 4 20 817 $16,266.54 $26,961.82 $10,358.46 $42,660.46 $8,567.53 $830.18 $0.00 $2,272.18 $5,460.96 $4,278.00 $986.92 $8,110.59 $0.00 $6,595.06 $2,041.91 $505.42 $2,811.70 $138,707.73 SUBCONSULTANTS 20000 Subconsultant Name Amount $158,707.73 Subconsultant Total: DIRECT EXPENSES Description Amount Mileage - Survey 800 mi @ $0.655/mi $524.00 Survey Equip. Fee - 4 days at $160/day $640.00 PerDiem Lodging - 6 days at $96/day $576.00 PerDiem Food, Travel Day - 6 days @ $44.25/day $265.50 PerDiem Food, Full Day - 4 days @ $59/day $236.00 Mileage - General 1000 mi at $0.655/mi.$655.00 Expense Total: Project Total:$151,604.23 $0.00 $2,896.50 Page 19 of 20 DRAFTDecember 5, 2023 J - 21 END OF EXHIBIT B DRAFTDecember 5, 2023 J - 22 Date: December 5, 2023 To: City Council From: Mike Healy, Director of Public Works & Utilities Derrell Sharp, Fire Chief Subject: Vehicle Purchase – Vehicle procurement to Equip PAFD Community Medics with Emergency Response Capable Vehicles. Background / Analysis: On August 15th Council awarded Opioid Settlement Funds to the Port Angeles Fire and Police departments for Operation Shielding Hope. A primary goal of Operation Shielding Hope is to establish an alternative response to opioid overdoses by equipping the Port Angeles Community Paramedics with emergency response capability which will enable them to respond to opioid overdose calls for service and provide point-of-care support, education, and referral services to opioid overdose victims. The success of Operation Shielding Hope is heavily tied to the ability for Community Paramedics to respond and provide supportive care, education and referral services immediately following a near fatal overdose. Since the inception of the Port Angeles Fire Department Community Paramedic Program the Community Paramedics have relied upon surplus and retired vehicles for their transportation needs. The 2004 Envoy (vehicle #4201) currently in use is not emergency response capable and becoming increasingly unreliable for even routine day to day non-emergency operations. The purchase of two (2) vehicles will be permanent additions to the fleet and will be funded for replacement through Community Paramedicine account #409-6027-526-4520. This will allow fleet to retire vehicle #4201, a previously slated for surplus vehicle. The new vehicles will feature emergency lighting and Fire Department markings. They will have Summary: The primary vehicle currently in use by the Port Angeles Fire Department Community Paramedic Program is a 2004 GMC Envoy (vehicle #4201) with nearly 140,000 miles of use and is a non-emergency response capable vehicle which has had numerous mechanical issues throughout 2023. The addition of two new vehicles to the Port Angeles Fire Department will provide reliable emergency response capable transportation that meets the needs of the program and adds to the safety of our employees. Opioid Settlement funds will be utilized for the purchase of two new Fire Department vehicles. Through the City’s membership in the Washington State Purchasing Cooperative, Bud Clary Ford of Longview, Washington was chosen from the cooperative vendors list: contract #05916. Funding: The purchase of two (2) new Fire Department vehicles will be funded utilizing the Opioid Settlement funds awarded through Operation Shielding Hope in an amount not to exceed $147,627.27. Recommendation: Approve the purchase and outfitting of two (2) new Fire Department 2024 F150 4x4 Pickup Trucks from Bud Clary Ford of Longview, Washington through the Washington State Purchasing Cooperative contract #05916 in an amount not to exceed $147,627.27, including tax, and authorize the City Manager to execute all contract documents necessary to complete the purchase and outfitting and make minor modifications as necessary. December 5, 2023 J - 23 trailer tow capabilities to enable transport of the Department Hazardous Materials Trailer and Mass Casualty Incident trailer and be 4-wheel drive equipped for all weather response. Staff has investigated electric powered truck options and have determined that no electric truck option is currently available or has been tested successfully that will meet the service demands of a Ford F150 4X4 emergency response capable unit. This determination is consistent with the Vehicle Replacement Program presentation given to City Council earlier this year. Funding Overview: This vehicle purchase is identified from opioid settlement funds for Operation Shielding Hope for the purchase and outfitting of two new Fire Department Emergency Response Capable vehicles, including applicable tax and accessories. Pricing from the Washington State Purchasing Cooperative contract is summarized below: New Vehicle Type WSPC Bid Accessories Tax Replacing Vehicle (2) 2024 Pursuit Rated Ford F150 4x4 Pickups $97,306.00 $38,756.00 $11,565.27 New Vehicle Addition Total Cost $147,627.27 December 5, 2023 J - 24 Date: December 5, 2023 To: City Council From: Nathan A. West, City Manager Subject: Holiday Fund Raising and Volunteer Opportunities Background / Analysis: The City will participate in several, equally meaningful initiatives of giving this year. City funds are not contributed to the efforts, however, organization members including Council and Staff have participated by volunteering time and personal funds. Below and attached are some dates and details on those efforts: 1.United Way Campaign: The City of Port Angeles kicked off the giving season with the 2023 United Way Campaign, a powerful opportunity to support vital programs in Clallam County. Donations can be made online, by paper form, or through payroll deduction – now through December 15th. 2.Shop With A Hero Project: This effort supports local foster children and those receiving support services through local and tribal social service programs. Last year, over 100 children were paired with a “hero” and given $100 to shop for Christmas gifts for themselves and their families! This year’s Shop With A Hero Event will be held on December 9th. Volunteers are needed that day for gift wrapping, photos with Santa, hot cocoa station attendants and shopper escorts. Community members can also donate funds that will help to support this event. 3.Salvation Army Angel Tree & Toys for Tots Charity Drive: In partnership with the Port Angeles Salvation Army and Marine Toys for Tots Foundation, the City will support local children through donations of gifts or toys. Each item donated will be gifted to a child in Clallam County who would otherwise go without. Both campaigns will take place during the first two weeks of December. 4.Operation Candy Cane: The Port Angeles Fire Department, accompanied by Santa, will travel the streets of Port Angeles from December 9-14th handing out candy canes in exchange for donations of non-perishable food items for local food banks. Collection volunteers are needed. For more information on how to participate with these donation and volunteer opportunities, please contact City Manager’s Office Administrative Assistant, Bri Howell. Funding Overview: n/a Attachment: Flyers from respective fund raisers Summary: Community donation and volunteer opportunities during the holiday season. Funding: n/a Recommendation: Information only. December 5, 2023 L - 1 December 5, 2023 L - 2 December 5, 2023 L - 3 BRAND NEW UNWRAPPED DROPPED OFF BY DECEMBER 15TH THANK YOU FOR YOUR SUPPORT Every child deserves a new toy and hope for the future this holiday season. DONATED TOYS MUST BE: PLEASE DROP DONATIONS IN THE DESIGNATED BIN IN THE JACK PITTIS CONFERENCE ROOM Spread holiday cheer and make a difference in our community! All toys are donated to children located in Clallam County. Toys for TotsToys for Tots Charity DriveCharity Drive City of Port Angeles December 5, 2023 L - 4 The Port Angeles Professional Firefighters Local 656, Volunteer firefighters, along with Santa Claus, will be traveling the streets of the City on a decorated 1956 Seagrave fire engine. Firefighters will be handing out candy canes to those who come out to meet them, while collecting cans of food or money for the Port Angeles Food Bank. December 5, 2023 L - 5